KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000766Help
Entry
AaeL_AAEL000766   CDS       T01053                                 

Definition
ubiquinol cytochrome C oxidoreductase-subunit 6.4kD-subunit, putative
Orthology
K00420  
ubiquinol-cytochrome c reductase subunit 10
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:aag00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 54 aa AA seqDB search
MRIPLGPKQAEQATKWISSAMGFGGAAALFGCYLTDWRVIVTYIPFYGGKFDEK
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgaggattccactgggcccgaaacaagccgaacaggccaccaaatggatctcttccgcg
atgggattcggaggagctgctgccttgttcggatgctatctgaccgactggagggtgatc
gtcacctatatcccgttctacggtggcaaattcgacgaaaagtag

DBGET integrated database retrieval system