KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000855Help
Entry
AaeL_AAEL000855   CDS       T01053                                 

Definition
mannosyltransferase 1, putative
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:aag00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 796 aa AA seqDB search
METIATSQEESSLRNRKAQRKGKSTAEETKNAENSSIVSDGENKQKLQRDNGDEPEKLKT
KSPPASGIDQSDRESVKSDNEPRFVIRVQLDGASVVLFVLSFVTRFFRLSHPNGVVFDEI
HYGRFASLYLRNTFYFDQHPPLGKMLIAGAASAVGYNGKFEFPKIGSEYDASVPIFAFRF
VPALCGSLLAPVVYSILRQLKLSQSIAIIGGLLIVFDNALLTHSRFILMEPMLLLFSAVG
LLFVLKFLNSQPFSVRWWSFGALAAASLTAGVCVKYVGFFSYVLACYIIGRHVWMQLPDR
NQSNMHLLVKGLTKATLFISVSIALYLGCFYIHLETLNKAGPHDSVMTSAFQASLEGGLA
SITKGQPLRIQHGSQITLKHTHGRVCWMHSHAHVYPIKYKDGRGSSHQQQVTCYGFKDVN
NWWIVKRPEKENIVVGEEPDYIQDGDVIQLVHGVTSRALNSHDVASAMTPLSQEVSCYID
YNISMPANLLWKVEIINAKDSKNKWNAITSQIRLIHVATNAALKFTGEQLPDWGFNQFEI
AADRRQYTIDTIWNVEEHRYTQDAERKDVLEKLLKTEMIPLEPTKLSFWDKFSELQMKML
LHAEKMEGHMYSSEPFDWPLMDKGIAYWVDGSSNAQIHLLGNLVIWYSATLAIVAYIGLL
VFYLIRRRRKFFDLSEDEWQQFRFGGEIFLAGYLIHYLPYYFVERTLFLYNYLPAILYKI
LLLCFVLEHIQLVIKKFVKAQLVSVIYSAVLYAWVAGVIYFFGKFSVLSYGTTELSADDV
LKLRLKDTWDLIVHKP
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaattgccacctcgcaggaggaatcgagcttacgcaaccgaaaggcgcaacga
aaaggaaagtccaccgcggaagaaacgaaaaatgcggaaaacagttccatcgttagtgac
ggggaaaacaaacagaaactgcaacgcgacaatggcgacgaacctgaaaagctcaaaacc
aaatctcctccagccagtggcattgaccaaagtgatcgtgaaagcgtgaaatcggataat
gagccccgtttcgtgatccgggttcagctggatggggcctcggtggtattatttgtgctg
tcgttcgtgacacggttttttaggctcagccatccgaatggggtcgtcttcgacgagata
cactatgggaggtttgcctcgctatacctccggaatacgttctatttcgatcaacatccg
cctctgggaaagatgctgatagcgggagctgccagtgccgtgggatacaacgggaagttt
gaattcccgaaaattggtagcgaatacgatgcgagcgttcccatctttgccttccgtttc
gtaccggcactttgcggaagtttgttggccccagtcgtctacagcatccttcgtcagctg
aaactcagccaatcaattgccatcatcggtggactactgattgtatttgacaacgcccta
ctcacacattcccgattcattctgatggaaccgatgttgctgctgttctccgccgttggc
ctcctgttcgtgctcaaattcctcaacagtcaaccattctccgttcgctggtggtctttc
ggagcccttgccgctgcatcgctcaccgctggagtttgcgtcaaatatgttggatttttc
agctacgttctggcatgctacatcatcggtcgtcacgtctggatgcaactgccagatcga
aaccaatcaaacatgcacctgctcgtgaagggtcttaccaaagccacactcttcatttcc
gtttctattgcgctatatctcggttgcttctacatccacttggaaaccctgaacaaagcg
ggtccccatgatagcgttatgaccagcgcttttcaagcttcacttgaaggtggccttgcg
tccattaccaaagggcaaccgcttcgtatccaacatggatctcagatcactttgaagcac
acccatggacgagtttgctggatgcattcgcatgcccacgtctacccgataaaatacaaa
gacggtcgaggctctagtcatcaacagcaagtcacttgctacgggttcaaggacgttaac
aattggtggattgtgaaacgaccggaaaaagagaacatcgtggttggtgaagaaccggac
tacatccaggatggagatgttatccagctggttcatggcgttacgagtcgtgcattgaat
tcacatgacgtggcttcagcaatgactccgctcagtcaagaagtgtcctgctacatcgac
tacaacatttccatgccagctaatctgctgtggaaggttgagataatcaacgccaaagat
tcgaagaacaaatggaacgccatcacatcgcagattcgattgattcacgtcgcaaccaac
gctgcactgaagttcaccggcgagcagcttccagattggggattcaatcagtttgaaatt
gctgccgatcgaaggcagtacacaatcgataccatttggaacgtggaggaacatcgttat
actcaggacgcagaaaggaaggacgtactggagaagttgttgaaaacggagatgatacca
ctggaaccgacaaaattatctttttgggacaaattcagcgagctgcagatgaagatgtta
cttcatgcggaaaaaatggaaggccatatgtactcatcggaaccattcgattggcctctg
atggacaagggaattgcttactgggtggatggttcatcgaatgcacagattcacctgctc
ggaaatctagtcatctggtactcggctacgctagcaatcgtggcgtacatcggcttactg
gtgttctacctaattagacgcagaagaaagttcttcgacctgagtgaggatgaatggcag
cagtttcgatttggaggcgaaattttccttgccggatacttgatccactatttgccatac
tattttgtggaaagaacgttgttcttgtacaactacttaccagcaattctgtacaagatt
ctactgctttgttttgtattggaacatattcagctggtgatcaagaaatttgtcaaagcc
caattggtctccgtcatctatagcgccgttctctatgcttgggtggctggagtgatctac
ttctttggcaagtttagcgtactcagctatggcaccaccgagctcagtgccgacgatgtt
ctgaaactgcggctgaaggacacctgggatctgattgttcataaaccttag

DBGET integrated database retrieval system