KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL000931Help
Entry
AaeL_AAEL000931   CDS       T01053                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AaeL_AAEL000931
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AaeL_AAEL000931
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AaeL_AAEL000931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 562 aa AA seqDB search
MNNQWRLVLSGLLCVLICDIGGVIGAAFRSPNSDDALFWRQQAESYLKRILQYEPNRKSG
AGVARNVIIFVGDGMGIASLSTGRIYKGQLAGRSGEEEVLSFDHFENSGFSKTYNTDRQV
PDSAGTATAMFTGVKTKYGYIGVDYSATATNEVAASVSNIMEWAQAVGKRTGFVTTTRVT
HATPAATFAHSFNRNWECEATIPANVRNKTKDIARQLVENAPGNKMNVILGGGRAAFGAS
IPDHLKTAFKFNGSMEKNCVREDGRNLVKDWLVSKNGSAATYVWNTAELMNAEVDDLDYL
MGLFADTHMSYERLRDTSEAGEPSLADMTEKAIRVLKRKHSNGFVLMVEGGRIDHAHHQN
HAHLALREVVELDRAVERALGMVDLDDTLIMVTADHSHSMTFNGYPDRGNDILGYANRPD
KLPYETITYANGPGFQTHRINDSSDDPSHLGTWIPVETMNRSAIDYRHLSAFYLGDETHG
GEDVAVFATGPGSSLVRGTFEQNYIAYVMSYAGCMGPAKRFNEACSFKPRAPSSGAESVG
NASSQLLISIVFLAVAKMCYHF
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccagtggagattggtgctaagtgggcttttgtgtgtcctaatctgtgatatt
ggaggagtgatcggcgcggcgtttcgatcgcccaacagtgatgatgccctcttctggcgg
cagcaggccgaatcctacctgaagcggatcctccagtacgaaccgaaccggaagagcgga
gcaggcgttgcgcggaacgtgatcatcttcgtcggcgatggaatgggcattgcgtcgctc
agcaccgggcgaatctacaagggacaactggcggggcgatcgggggaggaggaggttctc
agtttcgatcattttgagaactcgggcttttcgaagacgtacaacacggaccggcaggta
ccggattcagctggtacggccacagccatgtttaccggggtgaagacgaagtacggatac
atcggggtggactactcggcaacggctacgaacgaagtggcggcgagcgtttcaaatatc
atggaatgggcgcaggccgtggggaagcgtactgggttcgtaacaaccaccagggttacg
catgcgactccggcggctacctttgcccattcgttcaataggaattgggagtgtgaggct
acaattccggctaatgtgagaaacaaaaccaaggatattgctcgacagttggttgaaaat
gctccgggaaataagatgaacgtgattcttggaggaggacgggctgcctttggagcgtcg
attccggatcacttgaagacagcattcaagttcaatgggtctatggagaagaactgcgtc
agagaggacggtcgtaacttggtgaaagattggttggtcagtaaaaatggatcggcggcg
acctacgtatggaacacggccgagttgatgaacgccgaggtagatgacttagactacctc
atgggactgttcgccgatacgcacatgtcatacgaacgccttcgggatacgagtgaagca
ggagagccttcactagccgatatgactgagaaggccatcagggtgcttaaacgaaagcat
tcaaatggattcgtgttgatggttgaaggtggaagaatcgatcatgctcatcatcaaaat
catgctcatctggcgctgagggaggtcgttgaactggatcgcgctgtagagcgggcgttg
ggaatggtggacttggacgacacgctcatcatggttacggctgatcattcgcattctatg
acgttcaatggatatccagatagaggcaatgacattctcggttacgctaatcgaccggat
aagctgccgtacgaaaccatcacgtacgcaaacggtccaggattccaaacgcatcgtatc
aacgacagttcggacgatccgtcccacctaggcacctggattccggtcgaaaccatgaac
cgctccgccatagactaccggcacctatcggccttctacttgggtgatgaaactcacgga
ggagaagacgtggctgtatttgccaccgggccgggatctagtctagtccggggaacgttc
gaacagaactacatagcctatgtgatgagctatgccgggtgcatgggaccggccaagcgg
tttaacgaagcatgctccttcaaacctcgggcaccttcgagtggtgcggaatctgttggg
aatgcgtcctcccagctgttgatcagtattgtatttttagcggtagcaaaaatgtgctac
cacttttaa

DBGET integrated database retrieval system