KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001032Help
Entry
AaeL_AAEL001032   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL001032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 1263 aa AA seqDB search
MNHNRSKFTSFNDLSGVNLSRTLSSPVAESTHLEGPNNRSGLFASPAKVVGGSAKRKPTS
PLFNSRTTFKSSGNLSSVGFSRIDPQVYTDAQSRGLVNRLVKYHDRTQSPLNRSQSMTSV
YNKPGQFPVVHLKKTEIKYSPRRNNSVTSVRIAPPEKSVFQANTRSNILRAGSLLVPAEP
HLNRTRGPQPEDEIDAENRVIAPTAELDAAPTKSVLDALKEISRKRINNEELDADRIKKQ
CKELSEVDSGGGGGTKRARELPSSASPPLKGSSEQLQKKRLCCKNNDILSSLSSSLVMST
PKRVEPIPSRPRGLNMDQTFATNVATPVGLNTTVATERMIESREPALLTRIESAPLPQIV
RSVPEIVPAVRPKSTQPKITLFNKKYDETLVRPVVSDNEEQDDDEELGGRISFIKPKEKS
PILNSDKAALKQVEKSKLSLILSCLSEDNDDEEEPPKMVMNSHTVFKDTVDAPKPLPKVE
EKKPEVTIPKPPSGIAALINEPIKDPGLGKIEPPKPSIPKASEPPKPAEGFSFGTPAKTT
DLNATFNFQTPTKPVAAPVESKAPEKANGGFTLGTTAAVSTSSAPKSDAPPAYSFATANT
NSAPAMATPSGFGFGKSPPSSAATTTNTTTATPSLISFSPAPTSKNEPPKSGFSLLPAIS
TNASSGSPQNTLSTAKSSIPAFGSGSGFSAFKPLSPTASSTVTTTPASAAVPSFGTITAS
TPATTSPAATLSSTGGFSFGTGTSLKLTTAISTATTTTSAFSFGAATPVAPTPATVTPAA
FGATSAAPKFGFGSTTSSTVPSFGAPTTTATTAAPSFGGFSAKAAPPTTAPPAFGSVVSS
SNSTVTSPSAGIFGGSAAPAKPTTFGQVPSAANSTFSFGAQAQPAASTTTSNTGAFSFGG
AATSAQTATTTAAPVGATGSNIFGNASNSTAAPSFGAVPSFGTNPAPTFGATSPPAFGAS
TTSAAPVASGFGAPPVFGGSSGSLATSANTSSVFGGSSSVTSPFGATNSTPAASTTNLFG
AASSNNNQSNVTSSTPAPFSFGAAAGSTSTAAPANKPFAFGGIGTASTNNSNNSVLNSSV
SSGNLAKASSFSFSAGSNSTAPAPVAPQASFSFGNATNSSAAPPPAFGSSTGNTSFSFNA
NATNNTTTSNQAVVKPFSFGTPAQSAPAPSAAGAGIFGAAAASPPPAFNFSAGSNAAGST
VGGATPAPAFSFTGGAAAAPGGPFAMPNGTAPGGAPMFSIGTGGGSNLPPGRRPIRTATR
RLK
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacaatcggagtaagttcacgtcgttcaacgatctgagcggggtaaatctgagc
cgcacgcttagcagtccggtagcggaatcgacacacctggaagggccgaataaccggagc
gggttgtttgctagtccggccaaagtggtgggtggaagtgccaagcggaaaccaacgtca
ccactgttcaacagtaggaccaccttcaaaagcagtgggaacctgagctcggtgggattc
agtcggatcgatccacaagtttacacggatgctcagagccggggtttggtcaaccgcttg
gtaaagtaccatgacaggacacaatcaccactgaatcggagccagtcgatgaccagtgtg
tacaacaaaccgggccagttcccggtggtgcatttgaagaaaaccgaaatcaaatattcg
ccccggcggaacaattccgtgacgtcggttcgaattgcgccaccggagaagtccgtcttt
caagcgaacacgcgatcgaacatcttgagggcgggttcgctactggttccagcggagccc
catttaaataggacgaggggtcctcaaccggaagatgaaatcgacgcagagaacagagtt
atcgcaccgaccgcggaactggatgcggcaccgacaaagagtgtcctggatgccttgaag
gaaatttctcggaagcggataaataacgaagaacttgatgcggaccggattaaaaagcag
tgcaaggaactgtcggaggtcgattctggagggggcggcggaacaaagcgagccagagaa
cttccgtcatcagcttcgccacccttgaagggttccagcgaacagttgcagaagaagcga
ttatgttgtaagaacaatgatattctaagctcgttgagttccagtttggtgatgagtacg
cccaaaagggttgagccgattccgtcgaggccacgaggattgaatatggatcaaactttt
gctaccaatgtggcaactccagttggactgaatactacagtagcgaccgagaggatgatt
gagtcgcgagaaccggccttgctgacccgaatcgagtctgcaccgttgccacagatagtg
aggagtgtaccggaaatcgtccccgcagtgaggccaaaatcaacccagcccaaaattact
ctgttcaacaaaaagtatgacgagacgttggtgaggccagtggtaagcgacaacgaagaa
caagacgatgacgaagaactaggcggccggatcagtttcataaagccaaaagagaagtca
ccgattttgaacagtgataaagccgctttgaagcaggttgagaaatcgaagctttcgttg
attctcagctgtcttagcgaggataacgacgatgaagaagagcccccgaaaatggtcatg
aattctcacactgtgttcaaagatacggtggatgcaccgaaaccgctaccgaaggtcgag
gaaaagaaaccggaagtgacgatccccaaaccacccagtggaattgccgctttgatcaat
gaacccatcaaagaccctggcttgggtaaaattgagcctcccaaaccgtcgatacccaaa
gcaagtgagccacctaaaccagccgaaggattcagctttggaacaccagccaagacgaca
gatcttaacgctaccttcaatttccaaaccccaacgaaacctgttgctgctcccgtggaa
tcaaaggctccggagaaagcgaatgggggtttcacattaggaaccactgcagccgtctca
acttccagcgctccgaaaagcgatgctcctccagcctacagcttcgccacggccaacacc
aattccgctccggccatggcaacaccatccggctttggctttgggaaatctccaccatcg
tcagccgccaccactacaaatacaaccaccgcaactcccagcttgatcagtttctcaccg
gcgccaacgtccaagaatgagccgccaaagagtggcttttcgcttctaccagccatttct
accaatgcgtcatccggaagccctcaaaataccttgagcaccgctaaatcgtccatccca
gcattcggaagtggttccggattcagtgctttcaagcctctgtcacctaccgcttcctct
actgtaacaacaacccctgcatcggctgcggttccatctttcggaaccatcacggcatct
actcccgctacaaccagtccagctgccaccctctcctctactggtggcttttctttcgga
actggcacttccctgaaactaacgacagcgatatccaccgcaacaacaaccacaagtgct
ttctcctttggcgcggcaactcctgtggctcccacgccagcaacagtaactcctgctgct
ttcggagctacttccgctgcaccgaaattcggcttcggatcaactacttcctctaccgtt
ccctcgtttggcgccccaacgacgacagccaccacagcggcaccttcattcggtggtttc
tcagcaaaggccgctcctcctacgacggcacctcctgccttcggtagcgtggtcagttcc
agcaattccacagttacttcaccctcagcgggcatattcggaggctcagcagctcccgcc
aaaccgaccacgttcggtcaagtgccatccgccgctaactccacgttttcattcggtgcc
caagcgcaacctgcggcctccaccaccaccagcaacaccggggcattttcctttggaggg
gcagcaacgtcagcacaaacggccacaacgacagcagcacctgtgggcgctaccggaagc
aacattttcggcaatgccagtaacagcacagcagcaccgagtttcggtgcggtaccttcg
ttcggtacaaatccggcgccgacatttggtgccaccagtccccctgcgtttggtgcttcc
actaccagcgctgcaccggtggccagcggatttggggcaccacctgtgtttggtggtagt
tccggttcgttagctacttccgctaatacaagttccgtatttggtggctcttcatcggtc
acgtcgccattcggtgcaaccaactcgacaccggcagcatccaccactaacttattcggt
gctgccagttccaacaataatcaatccaacgtcacatcctcaactccggctccgttctcg
ttcggtgccgcggcaggctcgacatcaactgcagcaccagcaaataaaccttttgcattt
ggaggaatcggcaccgcaagcaccaacaatagcaacaacagtgtcctcaactcatcggtc
tcgtctggcaaccttgctaaagccagcagtttcagcttttctgcaggatcgaattccaca
gcaccagcaccggtagccccccaagcttcgttcagcttcgggaatgccaccaatagttct
gccgcccctccaccagccttcggcagcagcactggcaacacttctttctccttcaacgcc
aatgccaccaacaacaccaccacgagcaaccaagctgtcgtgaagccgttctcgttcggg
acaccggctcaatctgctcctgctccttccgcagctggtgccggaatcttcggtgctgct
gccgcatccccaccgccagcattcaatttctccgccggatcgaacgccgctggcagcact
gtgggcggcgccaccccagcaccagcattctcattcaccggtggtgctgcggcagcacca
ggaggtccctttgcgatgcccaacggaacggcaccgggaggggcaccgatgttcagcata
ggaaccggtggcggaagcaatctgcctcccgggcggaggcccattcggacggcaacccgc
cggctcaagtga

DBGET integrated database retrieval system