KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001032Help
Entry
AaeL_AAEL001032   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL001032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 1263 aa AA seqDB search
MNHNRSKFTSFNDLSGVNLSRTLSSPVAESTHLEGPNNRSGLFASPAKVVGGSAKRKPTS
PLFNSRTTFKSSGNLSSVGFSRIDPQVYTDAQSRGLVNRLVKYHDRTQSPLNRSQSMTSV
YNKPGQFPVVHLKKTEIKYSPRRNNSVTSVRIAPPEKSVFQANTRSNILRAGSLLVPAEP
HLNRTRGPQPEDEIDAENRVIAPTAELDAAPTKSVLDALKEISRKRINNEELDADRIKKQ
CKELSEVDSGGGGGTKRARELPSSASPPLKGSSEQLQKKRLCCKNNDILSSLSSSLVMST
PKRVEPIPSRPRGLNMDQTFATNVATPVGLNTTVATERMIESREPALLTRIESAPLPQIV
RSVPEIVPAVRPKSTQPKITLFNKKYDETLVRPVVSDNEEQDDDEELGGRISFIKPKEKS
PILNSDKAALKQVEKSKLSLILSCLSEDNDDEEEPPKMVMNSHTVFKDTVDAPKPLPKVE
EKKPEVTIPKPPSGIAALINEPIKDPGLGKIEPPKPSIPKASEPPKPAEGFSFGTPAKTT
DLNATFNFQTPTKPVAAPVESKAPEKANGGFTLGTTAAVSTSSAPKSDAPPAYSFATANT
NSAPAMATPSGFGFGKSPPSSAATTTNTTTATPSLISFSPAPTSKNEPPKSGFSLLPAIS
TNASSGSPQNTLSTAKSSIPAFGSGSGFSAFKPLSPTASSTVTTTPASAAVPSFGTITAS
TPATTSPAATLSSTGGFSFGTGTSLKLTTAISTATTTTSAFSFGAATPVAPTPATVTPAA
FGATSAAPKFGFGSTTSSTVPSFGAPTTTATTAAPSFGGFSAKAAPPTTAPPAFGSVVSS
SNSTVTSPSAGIFGGSAAPAKPTTFGQVPSAANSTFSFGAQAQPAASTTTSNTGAFSFGG
AATSAQTATTTAAPVGATGSNIFGNASNSTAAPSFGAVPSFGTNPAPTFGATSPPAFGAS
TTSAAPVASGFGAPPVFGGSSGSLATSANTSSVFGGSSSVTSPFGATNSTPAASTTNLFG
AASSNNNQSNVTSSTPAPFSFGAAAGSTSTAAPANKPFAFGGIGTASTNNSNNSVLNSSV
SSGNLAKASSFSFSAGSNSTAPAPVAPQASFSFGNATNSSAAPPPAFGSSTGNTSFSFNA
NATNNTTTSNQAVVKPFSFGTPAQSAPAPSAAGAGIFGAAAASPPPAFNFSAGSNAAGST
VGGATPAPAFSFTGGAAAAPGGPFAMPNGTAPGGAPMFSIGTGGGSNLPPGRRPIRTATR
RLK
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacaatcggagtaagttcacgtcgttcaacgatctgagcggggtaaatctgagc
cgcacgcttagcagtccggtagcggaatcgacacacctggaagggccgaataaccggagc
gggttgtttgctagtccggccaaagtggtgggtggaagtgccaagcggaaaccaacgtca
ccactgttcaacagtaggaccaccttcaaaagcagtgggaacctgagctcggtgggattc
agtcggatcgatccacaagtttacacggatgctcagagccggggtttggtcaaccgcttg
gtaaagtaccatgacaggacacaatcaccactgaatcggagccagtcgatgaccagtgtg
tacaacaaaccgggccagttcccggtggtgcatttgaagaaaaccgaaatcaaatattcg
ccccggcggaacaattccgtgacgtcggttcgaattgcgccaccggagaagtccgtcttt
caagcgaacacgcgatcgaacatcttgagggcgggttcgctactggttccagcggagccc
catttaaataggacgaggggtcctcaaccggaagatgaaatcgacgcagagaacagagtt
atcgcaccgaccgcggaactggatgcggcaccgacaaagagtgtcctggatgccttgaag
gaaatttctcggaagcggataaataacgaagaacttgatgcggaccggattaaaaagcag
tgcaaggaactgtcggaggtcgattctggagggggcggcggaacaaagcgagccagagaa
cttccgtcatcagcttcgccacccttgaagggttccagcgaacagttgcagaagaagcga
ttatgttgtaagaacaatgatattctaagctcgttgagttccagtttggtgatgagtacg
cccaaaagggttgagccgattccgtcgaggccacgaggattgaatatggatcaaactttt
gctaccaatgtggcaactccagttggactgaatactacagtagcgaccgagaggatgatt
gagtcgcgagaaccggccttgctgacccgaatcgagtctgcaccgttgccacagatagtg
aggagtgtaccggaaatcgtccccgcagtgaggccaaaatcaacccagcccaaaattact
ctgttcaacaaaaagtatgacgagacgttggtgaggccagtggtaagcgacaacgaagaa
caagacgatgacgaagaactaggcggccggatcagtttcataaagccaaaagagaagtca
ccgattttgaacagtgataaagccgctttgaagcaggttgagaaatcgaagctttcgttg
attctcagctgtcttagcgaggataacgacgatgaagaagagcccccgaaaatggtcatg
aattctcacactgtgttcaaagatacggtggatgcaccgaaaccgctaccgaaggtcgag
gaaaagaaaccggaagtgacgatccccaaaccacccagtggaattgccgctttgatcaat
gaacccatcaaagaccctggcttgggtaaaattgagcctcccaaaccgtcgatacccaaa
gcaagtgagccacctaaaccagccgaaggattcagctttggaacaccagccaagacgaca
gatcttaacgctaccttcaatttccaaaccccaacgaaacctgttgctgctcccgtggaa
tcaaaggctccggagaaagcgaatgggggtttcacattaggaaccactgcagccgtctca
acttccagcgctccgaaaagcgatgctcctccagcctacagcttcgccacggccaacacc
aattccgctccggccatggcaacaccatccggctttggctttgggaaatctccaccatcg
tcagccgccaccactacaaatacaaccaccgcaactcccagcttgatcagtttctcaccg
gcgccaacgtccaagaatgagccgccaaagagtggcttttcgcttctaccagccatttct
accaatgcgtcatccggaagccctcaaaataccttgagcaccgctaaatcgtccatccca
gcattcggaagtggttccggattcagtgctttcaagcctctgtcacctaccgcttcctct
actgtaacaacaacccctgcatcggctgcggttccatctttcggaaccatcacggcatct
actcccgctacaaccagtccagctgccaccctctcctctactggtggcttttctttcgga
actggcacttccctgaaactaacgacagcgatatccaccgcaacaacaaccacaagtgct
ttctcctttggcgcggcaactcctgtggctcccacgccagcaacagtaactcctgctgct
ttcggagctacttccgctgcaccgaaattcggcttcggatcaactacttcctctaccgtt
ccctcgtttggcgccccaacgacgacagccaccacagcggcaccttcattcggtggtttc
tcagcaaaggccgctcctcctacgacggcacctcctgccttcggtagcgtggtcagttcc
agcaattccacagttacttcaccctcagcgggcatattcggaggctcagcagctcccgcc
aaaccgaccacgttcggtcaagtgccatccgccgctaactccacgttttcattcggtgcc
caagcgcaacctgcggcctccaccaccaccagcaacaccggggcattttcctttggaggg
gcagcaacgtcagcacaaacggccacaacgacagcagcacctgtgggcgctaccggaagc
aacattttcggcaatgccagtaacagcacagcagcaccgagtttcggtgcggtaccttcg
ttcggtacaaatccggcgccgacatttggtgccaccagtccccctgcgtttggtgcttcc
actaccagcgctgcaccggtggccagcggatttggggcaccacctgtgtttggtggtagt
tccggttcgttagctacttccgctaatacaagttccgtatttggtggctcttcatcggtc
acgtcgccattcggtgcaaccaactcgacaccggcagcatccaccactaacttattcggt
gctgccagttccaacaataatcaatccaacgtcacatcctcaactccggctccgttctcg
ttcggtgccgcggcaggctcgacatcaactgcagcaccagcaaataaaccttttgcattt
ggaggaatcggcaccgcaagcaccaacaatagcaacaacagtgtcctcaactcatcggtc
tcgtctggcaaccttgctaaagccagcagtttcagcttttctgcaggatcgaattccaca
gcaccagcaccggtagccccccaagcttcgttcagcttcgggaatgccaccaatagttct
gccgcccctccaccagccttcggcagcagcactggcaacacttctttctccttcaacgcc
aatgccaccaacaacaccaccacgagcaaccaagctgtcgtgaagccgttctcgttcggg
acaccggctcaatctgctcctgctccttccgcagctggtgccggaatcttcggtgctgct
gccgcatccccaccgccagcattcaatttctccgccggatcgaacgccgctggcagcact
gtgggcggcgccaccccagcaccagcattctcattcaccggtggtgctgcggcagcacca
ggaggtccctttgcgatgcccaacggaacggcaccgggaggggcaccgatgttcagcata
ggaaccggtggcggaagcaatctgcctcccgggcggaggcccattcggacggcaacccgc
cggctcaagtga

DBGET integrated database retrieval system