KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001069Help
Entry
AaeL_AAEL001069   CDS       T01053                                 

Definition
histone deacetylase
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AaeL_AAEL001069
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AaeL_AAEL001069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1059 aa AA seqDB search
MEGSALGPDQAGVQLKDIYSNAMSSMELVRGETGLVYDERFAEHRCLWDEGYPECPERFT
RVLERCRELGLVDRCKMIEPRMATEEEILTKHTPEQVEILRGTKGSEDLERLEELSSHYD
AVFVHPSSYDCSLLACGSTIELVDAVVGGRVQNGMAIIRPPGHHAMKAEYNGYCFFNNVA
IAAQHALDRLGLKKILVVDWDIHHGQGTQRMFYDDPRVLYFSIHRYECGKFWPNLRESDF
DYVGEGAGLGYNFNVPLNRIGMANGDYLAIWQQILLPVAMEFQPELVLISAGYDAAYGCP
EGQMEITPAFYPHLLTPLMSLAQGRVAVILEGGYCLSSLAEGGALTLRTLLGDPCPLLVE
KLQPPCESMQQTILNCIHTHRPFWKNLQLNDTYGLEELNNVNPQPNFHQVIQYYVQPEPQ
PEPVRYETRNCYPLQSTEEKARIEERLAMLQIATRLTFPANRVCFVYDESLLEHRNVHED
HPEQPDRVAKIYTRHEEYKLLARMKRLKPRHATTTELCMVHSRQHVNVIRRTVEREEMKQ
VADQFNSVYFHPKTFECATLAAGSVLQVVDEVLNGQSRSGVCIVRPPGHHAESDMPHGFC
IFNNVAIAAQYAIRDHGLKRVLIVDWDVHHGNGTQHIFESDPRVLYISVHRYDNGTFFPK
STDANFDVVGSGSGEGFNVNIPWNKKGMGDQEYSAAFQQVILPVAYEFDPELVLVSAGFD
AAIGDPLGGCKVTPEAYGFFTHWLSSLANGRIVVCLEGGYNVNSISHAMALCTKSLLGDP
LPMLHLSSRYNGPNAACVETLRNVLSVQEKFWKSLRFNKKLPDFSNVSDAEPDLNGAFSR
MRLSTSATESSSSSSGSPSSAGSSPVKGKDESDVPCDGDEQPGPSRKRKTEDPVEAEPSA
GRCSTGEKHETLRDFLAANLEALQNEEMFAVVPLRDCPHLKELNPENIPEAISTKSPCTG
CDSAIENWVCLHCFRVHCARYINEHAMLHSVEADHAMALSFSDLSVWCYKCESYIDNPVL
YAYKNLVHRDKFDGEELVWSYGSDLFLDVAKPKPGKTKE
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atggaaggatcggcactaggaccggatcaggccggagtgcagctgaaggacatctacagt
aatgccatgtcctcgatggaactggtccgtggcgagacggggttggtttatgacgagaga
tttgccgagcatcgttgcctgtgggatgaagggtatccggagtgtccggagaggtttacc
cgggtgctggaacgttgtcgggagttggggctggtcgatagatgtaagatgattgaaccg
aggatggctacggaggaggaaatcctcacgaagcatactccggagcaggtcgagattctg
agagggacgaagggaagcgaggatctggaacggttggaggagcttagttcgcattacgac
gcagtttttgtgcacccgtcttcgtacgattgttcgctgctggcttgcgggagcacgatc
gagctggtagatgctgtcgtgggcggtcgggtgcagaacgggatggcgattattcgaccg
cccgggcatcacgccatgaaggccgagtacaatgggtattgcttcttcaacaatgtggcc
attgctgcccagcatgcgctggatcggttggggctgaagaagatcctggtggtggactgg
gacatccaccacggacagggaacgcagcggatgttctacgatgatccgagagtactgtac
ttttcgatccatcggtacgagtgcggcaagttctggccgaatctgcgggaatcggacttt
gactacgtcggagagggagctgggttgggttacaacttcaacgtgcccctcaaccggatc
gggatggcgaacggggactatctggccatttggcagcagattctgctgcctgtggcgatg
gagtttcaaccggaattggtgctgatttccgccggttacgacgcagcgtacggctgccca
gagggacaaatggagatcaccccggcattctatccgcatcttctaactccgctgatgtct
ctcgctcaggggcgtgtcgctgtcatcctggaaggtggttactgcctgtcatccttagcc
gaaggcggtgccctcaccttgcggacactcctcggcgatccttgtccactactggtagaa
aagctgcaacctccatgcgaaagcatgcagcaaaccatcctgaactgtatccacacccac
cgacccttctggaagaatctccagctgaacgacacgtacggtctcgaggagctgaacaat
gtcaatccgcagccaaacttccaccaggtgatccaatactacgtccaaccggaacctcaa
cccgaacccgtccgctacgaaacccgcaactgttatccccttcaaagcaccgaagagaaa
gcccgcatcgaggaacgtctggccatgctccagattgccactcgtcttacattccctgcg
aaccgcgtctgcttcgtgtacgatgagtcgctcctggagcaccggaacgttcacgaagat
cacccggaacaaccggatcgggtcgccaagatctacacccgccacgaagagtacaaactg
ttggcccggatgaagcgcctcaagccgcgacatgcgaccaccaccgaactgtgcatggtc
cactcgcggcagcatgtcaacgttatccggaggaccgtcgaacgagaggagatgaaacag
gtggcggaccagttcaactcggtctacttccacccgaagacgttcgaatgtgccacgttg
gcggctggttccgtcctgcaggtcgttgacgaagtgttgaacggtcaatcgagaagcgga
gtgtgcatcgttcgaccccctggccatcacgccgaatccgacatgccgcatggattctgc
atcttcaacaatgttgccatcgcagcgcagtacgccattcgagatcatggcttgaaacgg
gtgctgatcgtagattgggacgtccatcacggaaatggcacgcagcatatcttcgagagc
gatcctagggtgttgtacatatcggttcatcggtatgacaacgggacgttcttcccgaag
agtaccgatgcgaacttcgacgtagttgggtctggatcgggtgagggcttcaacgtgaac
atcccttggaacaagaagggcatgggagaccaggaatattcggcggccttccaacaggtt
atcctgccagtggcgtacgaattcgacccggagttggtgctagtatcagctggatttgat
gcggccatcggggatccgctaggtggatgcaaagtcactcccgaagcgtacggattcttc
acccattggctatcttcgctggccaacggtcgaatcgtagtttgtctggaaggaggctac
aacgtgaactcgatctcgcatgccatggcgttgtgcacgaaatcactccttggagaccca
ctgccaatgctacacctgagttctcgatacaacggaccaaacgctgcctgcgtggaaact
ttgcgaaacgtattgtcagtgcaggagaagttctggaagtcgttgcggttcaacaagaag
cttccggacttcagcaacgtctccgatgcggaaccggacctgaatggtgccttcagcaga
atgcgtctgtcaacgtcggccacagaatcttccagcagtagtagtggatcgccttcgtca
gcgggatcctcaccggtgaagggaaaggacgaaagcgacgttccgtgcgatggcgatgaa
caacccggtccaagccggaaaaggaaaacggaggacccggtggaggctgaaccaagcgcg
ggacggtgcagcaccggagaaaagcacgaaacgctcagggatttcttggctgccaatcta
gaggccttacagaacgaggagatgtttgctgtcgttcccttgagggactgcccacatctt
aaagaactcaacccggagaatattcccgaagccatcagtacaaaatccccttgcaccggg
tgcgactccgcgatagagaactgggtctgtctgcactgcttccgggtgcactgcgctcgc
tacatcaacgagcacgccatgctgcacagcgtggaggcggaccacgccatggccctcagc
ttcagcgacctctcggtgtggtgctacaagtgcgagtcctacatcgacaatccggtgctg
tacgcgtacaaaaacctggtccaccgggacaaattcgacggcgaagagctggtgtggtcc
tacgggagcgacctgttcctggacgtggccaaacccaagcccggcaagaccaaggaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system