KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001112Help
Entry
AaeL_AAEL001112   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AaeL_AAEL001112
Peptidases [BR:aag01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AaeL_AAEL001112
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AaeL_AAEL001112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 813 aa AA seqDB search
MEALQKHLGQIKVPCGSDNVYKEECVYSFDNPESPTGLYVSLSSFLGFGEEYARLYAEKS
GNRVFLHLKREKIEVAEPAQEGPEKKITRLAIGVEGGFPSEQKKYEFREHYKVVVLPEGV
SFAYPDQDLPLLVTNSVEGVLNAEAASVKREREQLTGTWDGEVRQVSQHAENLLQLDNGR
KIPPTGWKCERCDLTSNLWLNLTDGAILCGRKFYDGTGGNDHALNHYRETNYPLAVKLGT
ITGEGKGDVYSYQEDDMVVDPYLVKHLAHWGINVGQLEKTEKSMVELELDLNQKIGEWGI
LCESASNLKPIAGPGLTGMRNLGNSCYLNSVMQVVFTIPDFVRRFVDGSKDIFESFPADP
ANDFNVQMAKLGVGLCSGKYSVLTENSMDTVDSPSGIAPTMFKSLIGKGHPDFSTKHQQD
AQEFFLHLVNTLQKHSRNQADPADALKFSIEDRVECCSSGKVMYNRRDEWCLPLQIPLNL
ATNIAEVKKYEEDLALAEKEGRRLDPEALVRPKIPLSACLDTFAQPETVEQFYSTAINAK
TTAKKTTKLATMPDFLMLHLKKFTLRDDWTSVKLDVAIDIPEILDLETLRGTGKQPHEEE
LPELVGQAPSPPPMDPAVLEQLMVMGFPPEACKRAIFFTKNSGAEAATQWIMEHIADADF
AAPFVPPGTDTGKSTSAAAFVADPMGLEMLMGMGFTTQQATKALKETQNNTERAVDWIFS
HTDELNSMAMGGDGQETEAAAEPSTSSAAQYRDGTGKYKLVAFISHMGSSSQVGHYVCHI
LKDGQWVIFNDNKVAISQNPPKELGYLYLYQRV
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggaagccctccagaagcatctcggccagatcaaggtcccgtgcggcagcgacaacgtc
tacaaggaggagtgcgtctacagtttcgacaatccggaatctccgaccgggctttacgtc
agtttgagtagctttttggggttcggagaggaatacgcgcgtctttatgcggagaaaagt
ggcaatcgggtgtttttgcatttgaagcgggaaaagattgaagtggcggaaccggcgcag
gaaggaccggagaagaagattacgaggcttgcgattggagtggagggaggattcccatcg
gaacagaaaaagtacgagttccgggagcattataaggtggtggtgcttccggaaggggtg
agttttgcgtacccggatcaggatttgcctttgctggtgacgaattcggtggagggggtg
ttgaatgcggaagcggcctctgtgaagcgggagcgggaacagttgaccggaacatgggac
ggagaagtccgacaggtttcccagcatgctgagaatctgttgcagttggacaatggaagg
aagattccgccgaccggatggaaatgcgaacgctgtgatctgaccagtaatctgtggttg
aatttgacggatggggcgattctttgcggccggaagttctacgatggaaccggagggaat
gaccatgcgttgaatcactaccgggaaacgaactatccgttggctgtgaagctgggaacg
atcaccggtgagggcaagggagatgtctacagctatcaggaagacgacatggtggtagac
ccctacctggtcaaacacttggcccattggggaatcaatgtgggtcagctggagaagacg
gagaagtccatggtcgagttggagctggacctgaaccagaagattggagaatggggcatt
ctctgcgaaagtgccagcaatctgaagccaattgccggcccaggactgaccggaatgcga
aatcttggaaactcctgctatctgaacagcgtgatgcaagtggtcttcaccattccggat
ttcgttcgtcgattcgttgacgggtcgaaggacattttcgaaagcttcccagctgatccg
gccaacgacttcaacgtccaaatggcgaagctcggagtcggcttgtgcagtggcaaatac
agtgtcctcaccgagaacagcatggacacggtggacagtccttccggaattgccccgacg
atgttcaaatccttgattggcaaagggcatccggatttctcaaccaaacaccagcaagac
gctcaggagttcttcctgcacctggtcaacactctccagaaacattctcgaaaccaagcg
gatccggcggacgccctcaagttcagcatcgaagaccgcgtcgaatgttgctccagcgga
aaggtcatgtataatcgccgcgacgagtggtgtcttccccttcagatccccctcaatctg
gccaccaacatcgccgaggtcaagaagtacgaagaagacttggccctcgcagagaaggaa
ggtcgtcgcctagacccagaagctcttgtccgtccaaagatccccttgagcgcctgtctg
gacactttcgcccagccggaaaccgtggagcaattctacagcacggccatcaacgcgaaa
accactgccaagaagaccaccaagttggccacaatgcccgatttcctcatgctgcacttg
aagaaattcaccctccgagacgactggacctccgtcaagctggatgtcgcaatcgacatc
ccggaaatcctcgatctggaaaccctccgcggaactggcaagcaaccccacgaggaagag
ctccccgaactggttggccaagccccctcgcctcctcccatggaccccgccgttttggaa
cagctcatggtgatgggattccctccggaggcatgcaagcgagccatcttcttcaccaag
aactccggcgccgaagcggccacgcagtggatcatggaacatattgccgatgcagacttt
gcggcgccgttcgttcccccaggaaccgacaccggaaaatccacctccgccgccgctttc
gtggcggatccgatgggactggaaatgctcatgggaatgggttttaccacccagcaggcc
accaaggccctgaaggaaacgcagaacaacaccgaacgggccgtcgattggatcttttcc
cacacggatgaactgaacagcatggccatggggggagacggccaagagactgaagcagca
gcggaaccgagcacctcgagcgcagcgcagtaccgcgatggaacgggaaaatacaaactg
gtggcatttatctcccacatgggcagttcgtcccaggtcggtcactacgtgtgccacatc
ttgaaggacggccagtgggtgatcttcaacgacaacaaggtggccatatcgcagaaccct
ccgaaggagctgggctatctctacctctaccagcgagtctag

DBGET integrated database retrieval system