KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001165Help
Entry
AaeL_AAEL001165   CDS       T01053                                 

Definition
ras GTP exchange factor, son of sevenless
Orthology
K03099  
son of sevenless
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AaeL_AAEL001165
   04630 Jak-STAT signaling pathway
    AaeL_AAEL001165
   04068 FoxO signaling pathway
    AaeL_AAEL001165
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    AaeL_AAEL001165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 1553 aa AA seqDB search
MFAGGQHVSITDATDYDFEKAENAAKWKGVFITSLRKVLEQVHPSLQAREDALLYVESLC
LRLLAMLCAKPPPHTVLDVEERIGRTFPTPIDKWALSEARETIDKSKKKKSVLPVDRVHT
LLQKEVLQYKIDSSVSLFLVAVLEYISADILKLAGNYVKNIRHIEISREDIEVAMCADKV
LMDMFYQGDNSSSMAPSPLPPTPRTSLSYEEVVKELIHDEKQYQRDLHMIIRVFREELVK
IVKDPKELDPIFSNIMDIYEVSVTLLGSLEDVIEMSQEQTPPCIGSCFEELAEAAEFDVY
AKYAKDITSVQAKEALANLLSRPEANSLMSAGHGFREAVKFYLPKLLLGPIGHAQLYLDY
IKILLQLSPSQEDKESFEQVQGLLKPLQCELQGISSLLPKEYFARVNSRARRQSAIEKTR
DLQNSVEHWDKDVGQCCNEFIREDTLAKLSSGRRQTERKVFLFDGLLVLCKTRRQIVPGT
NYDYRLKERFFMRKVEIIDRPDTEELKYAFEISPREPTSVVLIAKNAQHKNDWMADLVML
NTKSMLERILDSILLDIEKKHPLKVPSPDIYAFAVPDSPSNIVLEEREGTGVPLIKGATL
TKLIERLTYHIYADPMFVRTFLTTYRSFCSPKELLRLLVERFDIPDPALVYDSASDKDLG
PDTDKFHKNSQREDWKRYKKEYVQPVQFRVLNVLRHWVDHHFYDFERDSELLEELLKFLE
TVRGKSMRKWVDSVLKIVQRKTESEDSHRQITFAFGHSPPAIEHHLPLTIGEEEYNLLML
HPLELARQLTLLEFEMYKNVKPSELVGSVWTGKDKETTSPNLLRIMHHTTNFTRWIEKSI
IEAENFDERVAMASRAIEVMMVLQDLNNFNGVLSIVSAFQGAAVHRLKLTLEEIPKSYQR
VLAECRELNNSHFKKYQEKLRSINPPCVPFFGMYLTNILHIEEGNPDFLPKTKLINFSKR
RRVAEITGEIQQYQNQPYCLKVDPSIRHFLENLDPFTGMSVTEIQNYLYEESKRIEPKNC
RQPLKFARKWPDISLKSPGIKPSSRRHNSSANSSLNLTGTLPFTNKAPLGNSNDTGAEQQ
SPTASSSSSSVLDYSIFAPVNIHSSSSSQHHQYHHHQQQMYNYQHHSQGSMQYYPGHHQS
GGGQQQNHHHYNHHGHQHNLSQSVVNLASTADHQMAPEIPRRSDSIILTPSLSSQVQYNL
NNSSLSESSSNTGGGSKLVPSPRYPSPQMHPIHGGTASTMDFNNCAISPTLSTSVSSTSS
VYQTTYNNSSTTADSMILNTTAASNDLGPPHSPHVNVPNTHNIPPPMPPPLPPRVKRKES
SGESSQSSQVRQAPDAPKLPPRDISPPPVPPRIHNPLHQICGNVQQQHQLLHSVGACDSC
NLVNVLPKDESPSSSSSSSTLTRDNLNQHNMSEQRLLMLPHTSTIMMRRNSAMDRASKEK
VSNITASPSLSGLSSTVGGVVGGGSTASSGPVSLSSSSAPPPPPCGAKNKSVQNSPVSQQ
QQQQPAVCGRRPSTNISPRFSPGETTPKLPPKPKQTNLSSHSDRTMFPYPSTN
NT seq 4662 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctggcggccagcatgtatcgatcacggatgcgacagattacgactttgagaaa
gcggaaaatgcagccaaatggaaaggtgttttcataacatcgctcagaaaggtattggag
caagtgcatccgtcgttgcaagcccgcgaggatgctctgctctacgtcgaaagtttatgc
ttgcgtttgttagcgatgctgtgtgcaaaaccaccaccgcatacagtattggacgtcgaa
gaacgaattgggcgtacgtttcctacgcccattgacaaatgggccctgagcgaggcacgt
gagacaatagacaaatccaaaaagaagaaatcggtgctaccggttgaccgagtccatacc
ttgctgcaaaaggaggtcctgcaatacaaaatcgatagttcggtttcattgttcctggtg
gcagtgctggagtacatttcggcggacatcctgaaactagctggcaactatgtcaagaac
attcgccacatcgagatatcccgggaggatatcgaggtcgccatgtgcgctgacaaggtg
ctcatggacatgttctaccagggagacaattcgagctcgatggcaccgagcccgttgccg
ccgacgcctcgtaccagtctcagctacgaagaggtggtcaaagagctcattcacgacgag
aagcagtaccagcgggacctgcacatgatcataagggtgtttcgcgaagagctggtcaaa
atcgtcaaggaccccaaggaacttgacccaatcttctcgaacattatggatatctatgaa
gtgtctgtaacgttactgggttcactcgaagatgtgatcgagatgtcgcaggagcaaact
ccaccatgcatcggaagctgtttcgaagaactagcggaagcggcagagtttgatgtgtac
gccaagtatgcgaaagatatcacgtcagttcaggcaaaggaagccttagcaaatttattg
tctaggccagaggcgaattcactgatgtcggctggtcacggtttcagggaagcggttaag
ttctatctaccaaaactacttttagggcctatcgggcatgcacagttgtatttagattat
attaaaattttactacagcttagtccctcgcaggaggataaggaaagcttcgagcaggtt
caaggtttgctgaaacccttgcagtgcgagttgcaaggcatatcctcactgctgcctaag
gaatatttcgctagggtaaatagtcgagctagacgtcagtcggcaattgagaaaactcgc
gacttacaaaacagtgtagaacattgggacaaggacgtggggcagtgttgcaacgagttc
attcgggaggatacccttgccaagctcagttccggcaggcggcaaaccgaacggaaggtg
ttcctatttgatgggttgttggtgttgtgtaaaacccgacgacagattgtgcctggcacc
aactacgattaccgattgaaggaacgctttttcatgcgcaaggtggagatcatcgatcgg
cctgacaccgaggagctcaagtatgctttcgagatctcaccccgggagccgactagcgtt
gtacttattgctaaaaatgcgcaacacaaaaacgactggatggctgatttggttatgctg
aacacgaaatccatgttggaacgcattctagacagtattctcctagatattgaaaagaaa
catccactcaaagtacctagtccggacatatatgcatttgccgtgcctgattcgccctcg
aatatagtgctggaagagcgagaaggcacgggagttccactgatcaagggcgccactcta
acgaaactgatcgaacggcttacctatcacatttacgccgatccaatgttcgtgcgtacc
ttcctaacaacgtaccgatcgttttgttcgcccaaagagcttcttaggttactggtggaa
cggtttgacataccggatccggcactagtgtacgacagtgccagcgacaaggatcttggg
ccagacacggacaagtttcataagaattcacaacgggaagactggaaacgctacaagaag
gagtatgtccaaccggtacagttccgggtactgaacgttcttcggcactgggtagaccat
catttttacgactttgaacgtgactccgagcttctggaagagttgttaaagttccttgaa
acggtacgcggtaaatcgatgcgaaagtgggttgactcagtgctgaagattgtgcaacgg
aagaccgaaagcgaagatagtcatcggcagataacgtttgccttcggccatagtccaccg
gcgatcgagcatcacctaccgctgactattggtgaggaggaatataacctgctgatgttg
catcctctggaacttgcccgtcagctaacgttgttagaatttgaaatgtataaaaatgta
aaaccatcggagctggtcggttcggtgtggaccgggaaagataaagaaactactagtcct
aatttattaagaattatgcatcacactacgaatttcacccgctggattgagaaatcaatt
atcgaggcggagaatttcgacgaacgtgtggcaatggcatcacgtgcaatagaggtgatg
atggttctgcaggatctaaacaacttcaacggtgtgctgtcgatcgtgtcggccttccag
ggggcggccgtccaccggctcaagctaacgctggaggaaatccccaagagctaccagcgg
gtgctggcagagtgtcgggagctgaacaattcgcacttcaaaaagtatcaggaaaagctg
cgttcaataaatccaccttgtgtgccattttttggaatgtatttaaccaatattttacat
atagaggaagggaatccagattttttaccaaagacgaaactaattaacttctctaagaga
agacgtgtagctgaaatcactggtgaaatacagcaatatcaaaatcaaccatactgtttg
aaagttgaccctagcattaggcattttctagaaaatttagatccttttacaggcatgagt
gtaaccgagatccaaaactatctctacgaggaaagtaaaaggatagagccgaaaaattgt
cgccaaccgttaaaattcgcacgcaagtggccagatatttcactaaagtctcccggcatc
aagccttcttcgagacgacacaacagttcggccaactcgtcattgaatctaacgggtacg
ttgccatttacgaacaaagcgccgcttgggaacagcaacgataccggtgcggaacagcag
tcaccaacagccagttcatcgtcgtcttccgtgctcgactattcgatatttgctcctgtg
aacattcactcttcgtcgtcatcacaacaccatcaataccatcaccatcagcaacaaatg
tacaactatcagcatcattcgcagggatcgatgcaatattatccgggccaccatcagtcg
ggtggtggccagcagcaaaaccatcaccattataatcatcacgggcatcagcacaacttg
tcccagtcagtggtcaatctcgcatcaacggcagaccatcagatggcgccggagattcca
cgacgttccgatagtattatccttaccccttcactatcgtcccaagtacagtacaaccta
aacaatagtagcttatccgaatccagcagtaataccggtggtggcagtaaactcgttcca
agccctcgctatccatccccgcagatgcatcccattcacggtggcacggcgtctacgatg
gatttcaacaactgtgccatctcgccgacgctgtccacctcggtttcgtcgacgtcctcg
gtgtaccagacgacgtacaataactcatcgacgacggccgattcgatgatcctcaacact
acggcggcgagcaacgacttgggcccgccccactcaccgcacgttaacgtaccaaataca
cacaatattcctcctcctatgccacctcctctacctcctagggttaaacgaaaagagtcc
tccggggagtcgtcacaatcttcgcaggtgcggcaagcaccggatgcacccaagcttcct
ccgagagatattagtccacctccggtaccaccacgtatccacaatccgttgcatcagata
tgcgggaatgtccagcaacagcatcagctgttacacagcgtaggagcttgtgacagctgc
aacctcgttaatgtattaccgaaggacgaatctccgtcttcatcatcctcgtcgtcgacg
ctgacccgcgacaacttgaaccagcacaacatgagcgaacagcggctactcatgctaccg
cataccagcacgatcatgatgcgacgaaactccgccatggatcgggcatcgaaggagaaa
gtgtccaacattaccgcatcgccgtcgctatccggactttccagtacagtggggggtgtg
gtcggcggtggaagtacggcgagtagtggaccagtcagcttatcctcatctagcgcacca
ccaccaccgccatgtggagcgaagaacaaatcagttcaaaactcacccgtatcgcaacag
cagcagcaacaacccgcagtttgcggtcgacggcctagtacgaatatatcgccgagattt
tcacccggagaaaccacacctaaattacctccgaagccaaagcaaaccaatctgtcatca
cattcagatcgaacaatgttcccctatccgagcacaaactga

DBGET integrated database retrieval system