KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001235Help
Entry
AaeL_AAEL001235   CDS       T01053                                 

Definition
palmitoyl-protein thioesterase
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AaeL_AAEL001235
  Lipid metabolism
   00062 Fatty acid elongation
    AaeL_AAEL001235
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AaeL_AAEL001235
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     AaeL_AAEL001235
Lipid biosynthesis proteins [BR:aag01004]
 Fatty acid synthase
  Component type
   AaeL_AAEL001235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 285 aa AA seqDB search
MHRFYTCFVLVIGLSIISAYRPVVIVHGILTGADSMLLIVDEIQRHHPGTVVYNTDRFEG
WSSLENAWHQVLEFNGDLQKICEKHPDGVILLGYSQGGLLARAVLQTYPDHCVKKFISLS
SPQAGQFGTDFLHLIFPSLVAKTAYQLFYTYVGQHTSVGNYWNDPHHQDLFEQFSIFLPY
INNDLPSTNSTLFRDSMLRLEQLILIGGPDDGVITPWESSHFGYYNESDDVIPCKKRKIY
LEDRIGLRTLDRDGRLKLITVPGVKHYEWHLNTDVVESVVLPHLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgattttacacttgttttgtgctagtaataggtttgagtatcataagtgcctac
agaccagtggttattgttcatggaatcctcactggagcggacagtatgctacttatagtt
gacgaaatacaaaggcatcatccgggaacagtagtgtacaatacggatcgattcgaggga
tggtccagtttggaaaatgcctggcatcaggttttagagtttaatggagacttgcagaaa
atatgtgaaaaacatccggacggtgtgatactgctagggtactcacagggaggtctgtta
gctagggcagtgctacaaacatatccagaccattgtgtgaagaagtttatatcattaagt
tcaccacaagccgggcagtttggaaccgatttcctgcatctgatattcccatcactggtt
gcgaaaacagcttatcagttattctacacctacgtcggtcagcacacttcggttggcaac
tactggaatgatccgcaccatcaggaccttttcgaacaatttagcatttttctgccttac
atcaacaatgatcttccatctacgaactcgaccttgtttagggattcaatgcttcggctg
gagcagttgattctaatcggagggcccgatgatggggttatcaccccgtgggaatcaagt
cacttcgggtactacaatgagtccgacgatgtaattccttgtaagaagcgaaaaatttat
ttagaggaccggattggcttgaggacattggacagagatggacggttgaaactgattact
gttccgggagttaagcactacgagtggcacctgaataccgatgtggttgagagtgtggtt
ttgccacatttggattag

DBGET integrated database retrieval system