KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001235Help
Entry
AaeL_AAEL001235   CDS       T01053                                 

Definition
palmitoyl-protein thioesterase
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aag01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:aag00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aag04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 285 aa AA seqDB search
MHRFYTCFVLVIGLSIISAYRPVVIVHGILTGADSMLLIVDEIQRHHPGTVVYNTDRFEG
WSSLENAWHQVLEFNGDLQKICEKHPDGVILLGYSQGGLLARAVLQTYPDHCVKKFISLS
SPQAGQFGTDFLHLIFPSLVAKTAYQLFYTYVGQHTSVGNYWNDPHHQDLFEQFSIFLPY
INNDLPSTNSTLFRDSMLRLEQLILIGGPDDGVITPWESSHFGYYNESDDVIPCKKRKIY
LEDRIGLRTLDRDGRLKLITVPGVKHYEWHLNTDVVESVVLPHLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgattttacacttgttttgtgctagtaataggtttgagtatcataagtgcctac
agaccagtggttattgttcatggaatcctcactggagcggacagtatgctacttatagtt
gacgaaatacaaaggcatcatccgggaacagtagtgtacaatacggatcgattcgaggga
tggtccagtttggaaaatgcctggcatcaggttttagagtttaatggagacttgcagaaa
atatgtgaaaaacatccggacggtgtgatactgctagggtactcacagggaggtctgtta
gctagggcagtgctacaaacatatccagaccattgtgtgaagaagtttatatcattaagt
tcaccacaagccgggcagtttggaaccgatttcctgcatctgatattcccatcactggtt
gcgaaaacagcttatcagttattctacacctacgtcggtcagcacacttcggttggcaac
tactggaatgatccgcaccatcaggaccttttcgaacaatttagcatttttctgccttac
atcaacaatgatcttccatctacgaactcgaccttgtttagggattcaatgcttcggctg
gagcagttgattctaatcggagggcccgatgatggggttatcaccccgtgggaatcaagt
cacttcgggtactacaatgagtccgacgatgtaattccttgtaagaagcgaaaaatttat
ttagaggaccggattggcttgaggacattggacagagatggacggttgaaactgattact
gttccgggagttaagcactacgagtggcacctgaataccgatgtggttgagagtgtggtt
ttgccacatttggattag

DBGET integrated database retrieval system