KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001407Help
Entry
AaeL_AAEL001407   CDS       T01053                                 

Definition
cdk4/6
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     AaeL_AAEL001407
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   AaeL_AAEL001407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 317 aa AA seqDB search
MAPTRQPQQHHTVSTMFQLSTNYEELNVIGTGAYGTVYKARDLSNEGNIVALKKVRVALT
EDGVPMSTLREIALLKQLDAFQHPNVVKLLDVCHGPRLEREGQLVLFLVFEHLEQDLDDY
IKRLPPGGMPRMTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLISAQGQLKLADFGLAK
TYDFEMKLTTVVVTLWYRAPEVLLGEPYHSSVDIWSSGCIIAEMFQRVALFPGTSEGNQL
EKIFELTGRPSESQWPRGISVARENFRPTQQREPRQMCPKLCDFSNDLLKKMLAFNPRER
PSALQCLQHPYFTQEPM
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaacgagacagccgcagcaacatcacaccgtgagcacgatgtttcaactgagc
accaactacgaggagctgaatgtaattggcacaggagcatatggcaccgtctacaaggca
cgtgaccttagcaatgaaggcaacattgtggccctgaagaaggttcgggtggccttgacc
gaggatggagtgccaatgtcgacgctgagagagatcgccttgctgaagcagctcgacgcc
ttccagcatccgaatgttgtcaaattgctggacgtttgccacggacctcgtctggagcgc
gaagggcagctggttctgtttctggtgtttgagcatcttgagcaggatttggatgactat
attaaacggcttcctcccggtggaatgccccggatgaccattcaacgtttgtcccgcgag
cttctcaccggagtcgatttcctgcactcgcatcgaatcatccatcgtgacttgaaaccg
cagaatctcctcatctcggctcagggtcagctcaagttggccgatttcggactggccaaa
acgtacgatttcgagatgaagctgacaaccgtggtggtaacgctgtggtatcgcgctccg
gaagtgctactcggtgagccctaccacagttcggtcgatatctggagttcgggctgcatc
attgcggaaatgtttcaacgggttgcgttgtttccgggcacgtcggaaggcaaccagttg
gagaaaatattcgaattaacgggaagaccttcggagagccagtggccacggggcatttcg
gtggcgcgggaaaattttcgaccgacccagcagcgagagccacgccagatgtgcccgaag
ctgtgcgatttctccaacgatctgctcaagaaaatgctggccttcaacccgcgggagaga
ccgtccgcgctgcagtgtcttcagcatccctacttcacacaggaaccgatgtga

DBGET integrated database retrieval system