KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001465Help
Entry
AaeL_AAEL001465   CDS       T01053                                 

Definition
protein-l-isoaspartate o-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AaeL_AAEL001465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 227 aa AA seqDB search
MAWRSRGLTNADLIRQLQEHGIIKSERVAQALIATDRKHYVASNLQPYLDAPQRIGHGAT
ISAPHMHAYALELLEPNLKSDSKVLDVGSGSGYLTACFARYIHQKQDATGYVVGIEHHPQ
LVELGRSNIKADDESLIDTKKVILVEGDGRKGFKEHAPYDCIHVGAAAPETPQELINQLK
PGGRMIVPVGPDGGTQYLEQYDKESDGKVVKTRLMGVMYVPLTDLHT
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgctctcggggacttaccaatgcagacctaatccgtcagctgcaagaacac
ggaataattaaaagtgaacgagtcgctcaggctttgatagcaacggatcgcaagcattat
gtggccagcaatttgcaaccctacttagatgccccgcaacggattggccatggggccacc
atcagtgcccctcatatgcatgcatacgctttggagcttcttgaaccaaatttgaaaagc
gatagtaaagtgctggatgtgggttccggttccggatatttgacggcatgttttgcccgc
tatatccaccagaagcaggacgcaaccgggtatgtggtcgggatagagcatcatccccag
ctggtcgaactgggacggtcaaacataaaggcagacgacgaaagcctaatcgacacgaag
aaagttattctcgttgagggagacggtcgaaagggcttcaaggagcacgcaccgtacgac
tgtatccacgtgggagctgctgcaccggaaacacctcaggaactgattaaccaactgaaa
ccgggtggccggatgatcgtacccgttggtcccgatggtggaacgcagtacctggaacag
tacgataaggaatccgacggcaaggtggtcaaaacgcgcttgatgggggtgatgtacgtc
cccttgacggatctacacacgtga

DBGET integrated database retrieval system