KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001478Help
Entry
AaeL_AAEL001478   CDS       T01053                                 

Definition
bile acid beta-glucosidase, putative
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aag00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aag00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 898 aa AA seqDB search
QVTAIPQYGLKLKFNHVYPETRNQNLKPSLRQIWPIIPMALRYIPYYWKVSRENRQVLMD
YWYTENGKQIYGAPIGGIGAGTIGRGFAGEFCRFQLKPGLYEYNTVHANQFIVTIKDENN
VTIFQSLLSSYRYVCTWCNDRYSDLFARKLGLVPIEIRPKNPLSSWETYINSSKCNYTAL
YPRAWSEYDLSDYGIKLVQRQISPIIPHDYKESSLPAAVFVWTVENVCGKDRQVTITFTF
KNGTGNKKQDAEGNSETAEFSHGSAKGVSIKQSIVDMQSTYCISCKTSSEINLTRCKKFD
PTGNGEKLWNDLKENGQLTEVSVEENLKSKDVAVAVSAQILVQSTGSSDLEFSLVWDMPK
IRFGKKTKEYYKYYTKYFGKSGDAGPSISDYALQNFGKWETLINEWQRPILDDNDLPDWY
KSAIFNELYFIADGGSVWLTTDDAELPYDDPRLAYGRFAYLEGHEYRMYNTYDVHFYASH
ALASLWPNLQVSLQYDYKDTINREISEGRKHLYDGKIIPRKIKNSVPHDLGDPDEEPFDL
INAYPIHDVSEWRDLNTKFILQVYRDYYTLNRYAQQNAENASKFSSIEFIDKESMYDTYV
QDNRNKVSPEEKQQNRKSASMYINETNGKVYLMDAMTYLKSMYPACKQVLEKTLEWDKDN
DGIIENSKCPDQTYDTWVMDGPSAYCGGLWLASLHCMTAMANLLDQNDDCNKFREILEKG
KTSFEEKLWNGTYYKFDGQSASKNTIMSDQLCGHWYLRCCGFDYDIFPKENVRTALKTIY
DNNVMRFCGGNMGAVNGYVPSTQPNKDGRADASTVQGEEVWTGVTYALASTMIHEGMFTE
AFQTAGGMYQTLSEKIGMNFETPEALYAERHYRAIGYMRPLSIWSLQTAWEQKKQNRD
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
caagtgacagcgatacctcaatacggtttaaagctcaaattcaatcacgtttacccggag
accaggaatcaaaatttgaaaccatctcttcgtcaaatatggcccattattccaatggct
ttgaggtacatcccctactactggaaggtgtcacgcgaaaaccgccaggtcttgatggac
tactggtataccgagaatggaaaacagatttatggtgccccgattggaggcattggcgcc
gggacgattgggcgtggattcgccggcgagttctgcagatttcagctcaaaccaggcctt
tacgagtacaacacggtgcacgcgaatcagttcatcgtcactataaaggacgaaaacaac
gtgaccattttccagagtttgctttcctcatacaggtatgtatgtacatggtgtaatgat
aggtatagtgatttattcgcgaggaaattgggattagtgcctatagaaatccggcccaag
aaccctctatccagctgggagacctacatcaactcgtcaaagtgtaactacacggccctg
taccctcgcgcttggtccgaatatgatctcagcgactacggcatcaagctggttcagcgt
cagatttcgcccatcataccccatgactacaaggaaagctctctaccggcggccgttttt
gtatggacagtggaaaacgtctgcggcaaggatcggcaggttaccatcaccttcacgttc
aaaaacgggaccggcaacaaaaaacaggatgcggaaggaaacagcgaaacggccgaattt
tcacacggttctgccaaaggagtcagtattaagcaaagcattgtcgatatgcagtccacg
tattgcatcagttgtaagacttcttcggaaatcaatctcacgcgctgcaaaaagtttgat
ccgaccggaaacggtgaaaagctgtggaatgatctaaaagaaaatggacagctgacggag
gtttcagtggaagaaaatttgaaaagtaaggatgttgctgtggctgtgagtgcccaaatt
ctagtgcaatcaacaggtagctctgatttggaattttccctagtctgggacatgccaaag
attagattcggtaagaaaacgaaggagtactacaagtactataccaaatactttgggaaa
tctggcgacgcggggccatcgatatcggattacgctctgcagaatttcggaaaatgggaa
actctaatcaacgagtggcagcggcctattctggatgataatgatcttccagattggtac
aagagtgccatatttaacgaactgtatttcattgccgatggtggtagcgtttggctaact
accgatgatgctgagcttccctatgatgatcctagactagcctatggacgattcgcctac
cttgaagggcacgaatatcgcatgtacaacacgtacgatgtacatttctatgcttctcac
gcactggcaagcctttggccaaatctacaagtaagtttacaatacgactacaaagacact
ataaaccgcgagatttctgaaggacggaaacatctctatgatggaaagatcattccgagg
aagattaagaactcagtgccgcacgatttaggcgatccagatgaggaaccgtttgatctg
atcaacgcctacccgattcacgacgtgtccgagtggcgggatttgaacaccaagtttatc
cttcaggtgtatcgggactactacacgctcaatcgctacgcacagcaaaatgccgaaaat
gccagcaagtttagttcaattgagttcatcgacaaggaaagtatgtacgatacgtatgtc
caggacaatcgtaacaaggtatcgccagaggagaagcagcaaaatcgaaaatctgcttcg
atgtacatcaatgaaaccaacgggaaggtgtatctaatggacgccatgacatatctcaag
agcatgtatcctgcgtgtaaacaagttttggagaaaactttagagtgggataaggataat
gacggtattatagagaacagcaaatgtccagatcaaacatacgatacttgggtcatggat
gggcctagcgcttattgcggtggactttggttggctagcttgcactgcatgactgcgatg
gcaaatttgctggatcaaaatgacgattgtaataagttccgtgagattttggagaagggt
aagacatcttttgaagaaaaactttggaatggaacttattacaaatttgacggtcaaagt
gcatccaaaaacacaattatgtcggaccagctgtgcggtcattggtacttacgttgctgt
gggtttgattacgatatctttccgaaggagaacgttcggacagccctgaaaaccatctac
gacaacaatgtgatgcgtttttgtggcggaaatatgggagctgtcaacggttacgtgcca
agtacgcaacccaataaggacggtagagcagatgcatctacagtgcaaggagaggaagtg
tggaccggtgtgacgtacgccttggcatcaaccatgattcacgagggaatgttcaccgaa
gctttccagaccgctggcggaatgtatcaaacgttgtccgaaaaaattggcatgaacttc
gaaacacccgaagcactgtacgcagagcgtcactatcgggccataggttacatgcgacca
ctcagtatttggtctttgcaaacggcttgggagcagaagaagcagaacagagattag

DBGET integrated database retrieval system