KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001478Help
Entry
AaeL_AAEL001478   CDS       T01053                                 

Definition
bile acid beta-glucosidase, putative
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AaeL_AAEL001478
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AaeL_AAEL001478
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AaeL_AAEL001478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 898 aa AA seqDB search
QVTAIPQYGLKLKFNHVYPETRNQNLKPSLRQIWPIIPMALRYIPYYWKVSRENRQVLMD
YWYTENGKQIYGAPIGGIGAGTIGRGFAGEFCRFQLKPGLYEYNTVHANQFIVTIKDENN
VTIFQSLLSSYRYVCTWCNDRYSDLFARKLGLVPIEIRPKNPLSSWETYINSSKCNYTAL
YPRAWSEYDLSDYGIKLVQRQISPIIPHDYKESSLPAAVFVWTVENVCGKDRQVTITFTF
KNGTGNKKQDAEGNSETAEFSHGSAKGVSIKQSIVDMQSTYCISCKTSSEINLTRCKKFD
PTGNGEKLWNDLKENGQLTEVSVEENLKSKDVAVAVSAQILVQSTGSSDLEFSLVWDMPK
IRFGKKTKEYYKYYTKYFGKSGDAGPSISDYALQNFGKWETLINEWQRPILDDNDLPDWY
KSAIFNELYFIADGGSVWLTTDDAELPYDDPRLAYGRFAYLEGHEYRMYNTYDVHFYASH
ALASLWPNLQVSLQYDYKDTINREISEGRKHLYDGKIIPRKIKNSVPHDLGDPDEEPFDL
INAYPIHDVSEWRDLNTKFILQVYRDYYTLNRYAQQNAENASKFSSIEFIDKESMYDTYV
QDNRNKVSPEEKQQNRKSASMYINETNGKVYLMDAMTYLKSMYPACKQVLEKTLEWDKDN
DGIIENSKCPDQTYDTWVMDGPSAYCGGLWLASLHCMTAMANLLDQNDDCNKFREILEKG
KTSFEEKLWNGTYYKFDGQSASKNTIMSDQLCGHWYLRCCGFDYDIFPKENVRTALKTIY
DNNVMRFCGGNMGAVNGYVPSTQPNKDGRADASTVQGEEVWTGVTYALASTMIHEGMFTE
AFQTAGGMYQTLSEKIGMNFETPEALYAERHYRAIGYMRPLSIWSLQTAWEQKKQNRD
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
caagtgacagcgatacctcaatacggtttaaagctcaaattcaatcacgtttacccggag
accaggaatcaaaatttgaaaccatctcttcgtcaaatatggcccattattccaatggct
ttgaggtacatcccctactactggaaggtgtcacgcgaaaaccgccaggtcttgatggac
tactggtataccgagaatggaaaacagatttatggtgccccgattggaggcattggcgcc
gggacgattgggcgtggattcgccggcgagttctgcagatttcagctcaaaccaggcctt
tacgagtacaacacggtgcacgcgaatcagttcatcgtcactataaaggacgaaaacaac
gtgaccattttccagagtttgctttcctcatacaggtatgtatgtacatggtgtaatgat
aggtatagtgatttattcgcgaggaaattgggattagtgcctatagaaatccggcccaag
aaccctctatccagctgggagacctacatcaactcgtcaaagtgtaactacacggccctg
taccctcgcgcttggtccgaatatgatctcagcgactacggcatcaagctggttcagcgt
cagatttcgcccatcataccccatgactacaaggaaagctctctaccggcggccgttttt
gtatggacagtggaaaacgtctgcggcaaggatcggcaggttaccatcaccttcacgttc
aaaaacgggaccggcaacaaaaaacaggatgcggaaggaaacagcgaaacggccgaattt
tcacacggttctgccaaaggagtcagtattaagcaaagcattgtcgatatgcagtccacg
tattgcatcagttgtaagacttcttcggaaatcaatctcacgcgctgcaaaaagtttgat
ccgaccggaaacggtgaaaagctgtggaatgatctaaaagaaaatggacagctgacggag
gtttcagtggaagaaaatttgaaaagtaaggatgttgctgtggctgtgagtgcccaaatt
ctagtgcaatcaacaggtagctctgatttggaattttccctagtctgggacatgccaaag
attagattcggtaagaaaacgaaggagtactacaagtactataccaaatactttgggaaa
tctggcgacgcggggccatcgatatcggattacgctctgcagaatttcggaaaatgggaa
actctaatcaacgagtggcagcggcctattctggatgataatgatcttccagattggtac
aagagtgccatatttaacgaactgtatttcattgccgatggtggtagcgtttggctaact
accgatgatgctgagcttccctatgatgatcctagactagcctatggacgattcgcctac
cttgaagggcacgaatatcgcatgtacaacacgtacgatgtacatttctatgcttctcac
gcactggcaagcctttggccaaatctacaagtaagtttacaatacgactacaaagacact
ataaaccgcgagatttctgaaggacggaaacatctctatgatggaaagatcattccgagg
aagattaagaactcagtgccgcacgatttaggcgatccagatgaggaaccgtttgatctg
atcaacgcctacccgattcacgacgtgtccgagtggcgggatttgaacaccaagtttatc
cttcaggtgtatcgggactactacacgctcaatcgctacgcacagcaaaatgccgaaaat
gccagcaagtttagttcaattgagttcatcgacaaggaaagtatgtacgatacgtatgtc
caggacaatcgtaacaaggtatcgccagaggagaagcagcaaaatcgaaaatctgcttcg
atgtacatcaatgaaaccaacgggaaggtgtatctaatggacgccatgacatatctcaag
agcatgtatcctgcgtgtaaacaagttttggagaaaactttagagtgggataaggataat
gacggtattatagagaacagcaaatgtccagatcaaacatacgatacttgggtcatggat
gggcctagcgcttattgcggtggactttggttggctagcttgcactgcatgactgcgatg
gcaaatttgctggatcaaaatgacgattgtaataagttccgtgagattttggagaagggt
aagacatcttttgaagaaaaactttggaatggaacttattacaaatttgacggtcaaagt
gcatccaaaaacacaattatgtcggaccagctgtgcggtcattggtacttacgttgctgt
gggtttgattacgatatctttccgaaggagaacgttcggacagccctgaaaaccatctac
gacaacaatgtgatgcgtttttgtggcggaaatatgggagctgtcaacggttacgtgcca
agtacgcaacccaataaggacggtagagcagatgcatctacagtgcaaggagaggaagtg
tggaccggtgtgacgtacgccttggcatcaaccatgattcacgagggaatgttcaccgaa
gctttccagaccgctggcggaatgtatcaaacgttgtccgaaaaaattggcatgaacttc
gaaacacccgaagcactgtacgcagagcgtcactatcgggccataggttacatgcgacca
ctcagtatttggtctttgcaaacggcttgggagcagaagaagcagaacagagattag

DBGET integrated database retrieval system