KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001916Help
Entry
AaeL_AAEL001916   CDS       T01053                                 

Definition
eukaryotic translation initiation factor 4e
Orthology
K03259  
translation initiation factor 4E
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:aag03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aag04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 211 aa AA seqDB search
MAGKSNEEVEKQTENTEQNHAEQGAVVDPECLIKHPLQATWTLWYQEPDRSKSWEDTLNE
VTSFSTVEDFWSLYNHIKSPADIKVGSDYSLFKKDIRPMWEDEGNKRGGRWMVNVPRSQR
QDLDKYWLDTILCLIGEAFESSDEICGAVVNVRPKGDKIAIWTANFQNREAVINIGRIYK
ERLGLKAPLTYHLHKDTMVKSGSSVKAVYTL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaaatccaacgaagaagttgagaagcaaacggagaacaccgagcagaaccac
gctgagcagggagcagtcgtcgatccagaatgcctaatcaagcacccgttgcaagccact
tggaccctctggtaccaggaaccggatcgcagcaaatcgtgggaagataccctcaatgag
gtgaccagcttttccaccgtggaggacttttggagtttgtacaatcacattaagagcccg
gccgatatcaaggtcggaagcgattactctctgttcaagaaggacatccgtccgatgtgg
gaagacgagggcaataagcgtggcggccgatggatggtcaacgtgccgcggtcgcagcgt
caggatttggacaagtactggctggatacgattttgtgtctcattggagaagcattcgaa
agttcagatgagatttgcggagccgtagtgaacgtacgcccgaaaggagacaaaattgcc
atttggactgccaacttccagaaccgcgaagccgtcatcaacattggtcgcatttataag
gaacggttaggactaaaagcaccgctcacataccatcttcacaaggacacgatggtcaaa
tccggatcgagcgtgaaagccgtctacaccctgtag

DBGET integrated database retrieval system