KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001916Help
Entry
AaeL_AAEL001916   CDS       T01053                                 

Definition
(RefSeq) AAEL001916-PA
  KO
K03259  
translation initiation factor 4E
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL001916
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    AaeL_AAEL001916
Messenger RNA biogenesis [BR:aag03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AaeL_AAEL001916
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AaeL_AAEL001916
Translation factors [BR:aag03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AaeL_AAEL001916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 211 aa AA seqDB search
MAGKSNEEVEKQTENTEQNHAEQGAVVDPECLIKHPLQATWTLWYQEPDRSKSWEDTLNE
VTSFSTVEDFWSLYNHIKSPADIKVGSDYSLFKKDIRPMWEDEGNKRGGRWMVNVPRSQR
QDLDKYWLDTILCLIGEAFESSDEICGAVVNVRPKGDKIAIWTANFQNREAVINIGRIYK
ERLGLKAPLTYHLHKDTMVKSGSSVKAVYTL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaaatccaacgaagaagttgagaagcaaacggagaacaccgagcagaaccac
gctgagcagggagcagtcgtcgatccagaatgcctaatcaagcacccgttgcaagccact
tggaccctctggtaccaggaaccggatcgcagcaaatcgtgggaagataccctcaatgag
gtgaccagcttttccaccgtggaggacttttggagtttgtacaatcacattaagagcccg
gccgatatcaaggtcggaagcgattactctctgttcaagaaggacatccgtccgatgtgg
gaagacgagggcaataagcgtggcggccgatggatggtcaacgtgccgcggtcgcagcgt
caggatttggacaagtactggctggatacgattttgtgtctcattggagaagcattcgaa
agttcagatgagatttgcggagccgtagtgaacgtacgcccgaaaggagacaaaattgcc
atttggactgccaacttccagaaccgcgaagccgtcatcaacattggtcgcatttataag
gaacggttaggactaaaagcaccgctcacataccatcttcacaaggacacgatggtcaaa
tccggatcgagcgtgaaagccgtctacaccctgtag

DBGET integrated database retrieval system