KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001916Help
Entry
AaeL_AAEL001916   CDS       T01053                                 

Definition
eukaryotic translation initiation factor 4e
Orthology
K03259  
translation initiation factor 4E
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL001916
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    AaeL_AAEL001916
Translation factors [BR:aag03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AaeL_AAEL001916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 211 aa AA seqDB search
MAGKSNEEVEKQTENTEQNHAEQGAVVDPECLIKHPLQATWTLWYQEPDRSKSWEDTLNE
VTSFSTVEDFWSLYNHIKSPADIKVGSDYSLFKKDIRPMWEDEGNKRGGRWMVNVPRSQR
QDLDKYWLDTILCLIGEAFESSDEICGAVVNVRPKGDKIAIWTANFQNREAVINIGRIYK
ERLGLKAPLTYHLHKDTMVKSGSSVKAVYTL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaaatccaacgaagaagttgagaagcaaacggagaacaccgagcagaaccac
gctgagcagggagcagtcgtcgatccagaatgcctaatcaagcacccgttgcaagccact
tggaccctctggtaccaggaaccggatcgcagcaaatcgtgggaagataccctcaatgag
gtgaccagcttttccaccgtggaggacttttggagtttgtacaatcacattaagagcccg
gccgatatcaaggtcggaagcgattactctctgttcaagaaggacatccgtccgatgtgg
gaagacgagggcaataagcgtggcggccgatggatggtcaacgtgccgcggtcgcagcgt
caggatttggacaagtactggctggatacgattttgtgtctcattggagaagcattcgaa
agttcagatgagatttgcggagccgtagtgaacgtacgcccgaaaggagacaaaattgcc
atttggactgccaacttccagaaccgcgaagccgtcatcaacattggtcgcatttataag
gaacggttaggactaaaagcaccgctcacataccatcttcacaaggacacgatggtcaaa
tccggatcgagcgtgaaagccgtctacaccctgtag

DBGET integrated database retrieval system