KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001976Help
Entry
AaeL_AAEL001976   CDS       T01053                                 

Definition
camp-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    AaeL_AAEL001976
   04340 Hedgehog signaling pathway
    AaeL_AAEL001976
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AaeL_AAEL001976
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   AaeL_AAEL001976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 405 aa AA seqDB search
MPRWERWEQFKRQIFTRRRYPKPTMSEPVVKSAATIKNLTPSAVKTSPLAVSGVRPAVKK
FSHNSEYKQILNRLKVDFEKKYNNVKASSGNGLQDYDVLKTLGTGAFGVVKLIRRKNTEE
YFALKILSKEKIVRHKQLQHTANEKRILQSVEFPFLVNMECCFKDNSYIYLVMPFVCGGE
MFALLRKSKRFGEEQAKFYGAQVALAIEYLHHMNLIYRDLKPENILIDMKGYVKITDFGF
CKLIRDRTWTLCGTPEYLAPEIIQSKGYGKSVDWWSFGILLYEMAAGYTPFYTNSSDHMV
LFEKICKGKFRFPAGFGGDLKHLIQNILHADLTRRFGNLKNGANDIKQHIWFRGTNWIGL
MNMEVSAPFIPKISGPGDASQFDIYDEQDLKIASKCMFIKEFADF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccaagatgggaacgatgggagcagttcaaacgtcagatcttcacccgaaggcgctac
ccgaagccaacaatgtccgagccggtagttaaatcggccgctacgattaagaacctgaca
ccgtcagccgtcaagacaagcccgttggcggtcagtggcgtccggcctgcggttaaaaag
ttttcccacaacagtgagtacaagcaaatactgaaccggttaaaggtggactttgagaaa
aagtacaacaacgtgaaggcctcgtccggcaatggactgcaagattatgatgtccttaaa
acgctcggcacgggagcatttggtgttgtgaaactgatccgcagaaagaacactgaggaa
tatttcgcgctcaaaattttatccaaagagaagatagtccgccacaagcaactgcagcac
acggccaacgagaaacggatactgcaaagcgtggagtttcccttcctggtgaacatggaa
tgctgtttcaaggacaattcctacatctatctggtgatgccgttcgtgtgtgggggcgag
atgtttgccctactgcggaagtccaaacgcttcggggaggaacaagccaagttctatggg
gcacaggtggccctagcgatagagtacctgcaccatatgaacctgatctaccgggacttg
aagccggagaatattctaatcgacatgaagggctacgtgaagataacggattttggcttt
tgcaagttaatccgcgatcgaacttggaccctttgcggtacgcccgagtatctggccccg
gagatcatacagtccaaaggttatggcaagagcgtagactggtggtcatttggcattctt
ctgtacgaaatggcagcaggatacacgccattttatacgaattccagcgaccacatggtg
ctatttgagaaaatatgcaaagggaagtttcgctttcctgcgggttttggcggtgatctg
aaacatctgatccagaatatactgcacgcggatctaacgagacggtttggaaacttgaag
aacggcgccaacgatattaaacagcatatctggtttcgcgggacgaactggatcggattg
atgaatatggaagttagtgcgccttttattcccaaaataagcggtcccggagacgcttct
cagtttgatatctacgacgagcaagatctaaaaatagcctctaaatgtatgtttattaag
gaatttgcagatttttaa

DBGET integrated database retrieval system