KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL001978Help
Entry
AaeL_AAEL001978   CDS       T01053                                 

Definition
uroporphyrinogen iii synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aag00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 253 aa AA seqDB search
LTQLMMKKVVILKSESDNSEAYPALLRKHGFEPIFVPTLDFSFRLDILRDRLLSPYSIRY
HSPRAITAVRDALDGNRLKDDWKPLENYSVGETSSELIQRTLELDTKGQHSGNASNLADF
IKTDLYNKTVTLPFLFPCGNLKQDVLQNKLSEYGYSLDCVEVYETVPHRDLERNLVELFR
EGAEQPGYLLFFSPSGMNYCASVFERHKLDINGCRIVAIGPSTKKAIENKGYAVHRTAEK
PSPEYVVSALLDT
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttaactcaattaatgatgaaaaaagtagtcatcctcaagtcggagagtgacaacagcgaa
gcctacccggcgcttctgcggaaacacggcttcgagcccatctttgtgccaacgttggat
ttttctttcagactagacatccttcgggaccgtctcctgtcaccgtacagtattcggtat
cacagtccgagggccataacggccgttcgggacgccctggatgggaaccgcttgaaggac
gactggaaaccgctggagaattactccgttggcgaaaccagctccgagctgattcagcgc
acactcgaactggacaccaaagggcaacactccggaaatgctagcaatttggcggatttc
atcaaaacggatctttacaacaaaacagtgacacttccgtttctgttcccttgcgggaat
ctcaaacaggacgtgctccagaacaaactgtccgagtatggatactcgctggattgcgtc
gaagtgtacgaaacggtgccccatcgggacctggaacggaatctggtggaactgttccgt
gaaggtgcggagcagccggggtatttgttgtttttcagcccgtccggaatgaattactgc
gctagtgtttttgagaggcacaagctggatatcaatggctgccggattgtagccatcgga
ccgagcaccaaaaaagccatcgagaacaaaggctacgcggtgcatcgaacagcggagaaa
ccttcacccgagtatgtcgttagtgctttactagatacctag

DBGET integrated database retrieval system