KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002002Help
Entry
AaeL_AAEL002002   CDS       T01053                                 

Definition
mitochondrial ribosomal protein, S18B, putative
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Ribosome [BR:aag03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    AaeL_AAEL002002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 208 aa AA seqDB search
MSLLRVVSREIFAAYRQGIVSTTANRSFRTSAQRLADKAESSEGVAAGEDSIEGQEESNK
GQVREDPKDRTRIIPVETSIRYLASEAYQQTYQGEPVWKQYRRNHKGVYPPKQTRKTCIR
QGKLATGNPCPICRDEFLVLDHRNTDLIKQFVSSQSGKVLSYQITGLCQKRHLELLVAVE
RAMDYGLITFDVPFRDYDYSEYYPAQKQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcattactccgagtagtaagtcgcgaaatatttgccgcctatcgccagggaatcgtt
tccaccaccgcaaatcgatcgttccggacgtccgcccaacgattggccgataaggcggag
tcgtctgaaggcgttgccgctggggaggattcaatagaaggccaggaggaatccaacaag
ggacaggtacgagaggatccgaaagatcgtacgcgcattattccggtcgagaccagcatc
cggtacttggccagtgaagcgtatcaacaaacttaccaaggcgaaccggtgtggaagcag
taccgaaggaaccacaagggagtttatccgcctaagcaaacccgcaagacgtgcatccga
cagggtaagcttgcgaccggaaatccttgccccatttgccgggacgaatttctggtactg
gaccacaggaacaccgatctgatcaagcagtttgtgtcctcgcaaagtggaaaggtgctc
agctaccagattacgggactgtgccagaagcggcacctcgaactgctggtggccgtcgaa
cgggctatggactacggtttgataacgttcgatgtgccattccgggattacgactactcc
gaatattacccggcgcagaagcagtag

DBGET integrated database retrieval system