KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002194Help
Entry
AaeL_AAEL002194   CDS       T01053                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aag00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:aag00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 325 aa AA seqDB search
MMSRKLVEESRDAGFRDVPDHYKISNYGYGKDSVKVLHVMRNGLVHSIKEFEVGTKLKLA
SQKDYLQGDNSDIVATDSQKNTVYLLARKHGLKSPEEFGILLCDHFLNKYSHVNEVSIHI
DEYPWSRMGFGKGPYQDLHNHAFVFTPTAIRYCDVTQKRGDSMPTVISGLSDLRVLKTTQ
SAFVNFVNDEYRSLPDQHDRIFSTVIRSSWQFSSVAGVDFDFCWNKVKQCILNTFAGETE
KGIFSPSVQNTLYLAEKLVLESIPEVSSIDMTMPNKHYFNFDFSKFPKLVQGEELKEETV
FLPVDKPAGIIYAQLDRKKVTKSKL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccagaaagttggttgaagaatcacgcgacgccggatttcgtgacgtaccggat
cactacaagataagcaactacggctatggcaaggacagcgttaaggttttgcacgtaatg
cgtaatgggttggttcacagtattaaggagttcgaggtcggaaccaagttgaagctggcc
agccagaaggattacttgcaaggtgacaacagcgacattgtcgctacagactctcagaag
aacacggtatatttgttggcacgcaagcatggattgaaatcaccggaagagtttggaatt
ctgctgtgcgatcacttcttgaacaaatactcccacgtcaacgaagtttccattcacatc
gatgagtatccttggtcacgaatgggcttcggcaagggaccctaccaggatctgcacaac
cacgcgtttgtgttcactccgacagccattcggtattgcgacgttactcagaagcgagga
gattcaatgcccacggtcatcagtggcctcagtgacttgcgcgtgctcaaaacgacccag
tcggcgttcgtgaacttcgtcaacgatgagtaccgttcgctgccggatcagcacgatcgc
atcttcagcaccgtgatccgttcctcctggcagttctcatccgtggccggagtggacttc
gatttctgctggaacaaggtcaagcaatgcatcctgaacaccttcgctggcgaaaccgag
aagggtatcttctcgccaagtgtccagaataccctgtacctggcggagaagctggtgctc
gaaagcatcccggaagtgtcctccatcgatatgaccatgcccaacaagcactacttcaat
tttgacttcagcaaattccccaagttggtgcagggagaggaactgaaggaggaaaccgtt
ttcttgccggtggacaagcctgctggaatcatctatgcacagttggaccgcaaaaaggtg
acgaagagtaagctgtag

DBGET integrated database retrieval system