KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002304Help
Entry
AaeL_AAEL002304   CDS       T01053                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AaeL_AAEL002304
Enzymes [BR:aag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AaeL_AAEL002304
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AaeL_AAEL002304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 327 aa AA seqDB search
MSSLTKLHSSIFHPTLRKLQCQDVDIAAHNLMYPVFLVEDDDAVQEIPSMPGVARYGLTT
LKKHLTPLVEKGLASILLFGVVDKLPKDPTGSGADSAENPVVKALPQLRQWFPDLLIACD
VCLCPYTSHGHCGVLTADGVIDNEPSIQRIAEIAFAYAKAGAHIVAPSDMMDNRIWAIKK
ILRENKMENTVSVLSYSVKFASGFYGPFRDAAKSAPAFGDRKCYQLPPGSKGIAKRAAKR
DVEEGADMLMVKPGMAYLDIVKQVKDDYPELPLFIYQVSGEYSMLLNAGKIGAFDLRTVL
WEVLIGMRRAGADCIITYFTPTLLDWL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctctaacgaaactccacagcagtatcttccatccgacgttgcggaaactccag
tgccaggatgtagacatcgccgcacacaatcttatgtacccggtatttttggtagaggac
gatgacgcagttcaggaaatcccgagcatgcctggcgtcgccaggtatggactcacaact
ctcaagaagcacctgacaccattagtagagaaaggccttgcatcgattcttctattcgga
gtcgttgacaaactgccaaaggaccccaccggaagcggggccgattcagccgagaacccc
gtcgtcaaggcccttccacaactccggcaatggtttccagatctcctgatcgcgtgcgac
gtctgtctgtgcccatacaccagccatggtcattgtggagtccttacggcggacggagtc
atcgacaacgaacctagcatccagcggattgcagaaattgctttcgcgtatgccaaagcc
ggagcccatattgtggctccctcggacatgatggataaccgtatttgggcgattaagaag
atcctaagggagaacaaaatggagaatactgtttcggtgctgtcctactcggtcaaattt
gcatctgggttctacggaccgttccgggatgcggccaaatcggcaccggctttcggggat
cgcaagtgctaccagttgccacccggctccaaggggattgccaaacgagctgcgaaacga
gacgtcgaagagggcgctgacatgctgatggtcaaaccgggcatggcttacttggacatt
gtcaagcaagtcaaggacgattatccggaattgccgctgttcatctatcaggtgtccggc
gaatactcgatgttgctgaacgccggcaaaattggtgccttcgatctgcgaaccgtcctg
tgggaggtgctgattgggatgcggcgtgccggagcagattgcatcattacgtacttcacg
cccacgctgctcgattggttgtga

DBGET integrated database retrieval system