KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002341Help
Entry
AaeL_AAEL002341   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AaeL_AAEL002341
Enzymes [BR:aag01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AaeL_AAEL002341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 851 aa AA seqDB search
MRRSKAPSMKGLAKPDLATSRQSHSLAQKIPMDKADSVVANLLHSDEDHVDILKRLAVEK
HPASMSSKTVTTGNDFLAKIRYKVVWGKISTKKHKTWEGDGTLEILGRTATLKDEDGKTI
ASSTGLKLDSIEEGSRLIVGSKEVELIEKASDITGSETEKQSSEQIVPQLKKARVEVFKP
PAVYEETKKASSGSSFKQVGTVEEIPPDFVPLVMSQPSFEHQWKYNQKKAPLSKVTVPYA
LSKHLRPHQREGVSFLYECVLGFRYTDADRFGAILADEMGLGKTLQCISLIYTLMKQGPY
SQPILKRILIVTPSSLMENWDREISKWLKTERIFTFIVSPTNPLKKYAQSAHIPILIISY
ELLSKQIRELDSVKFDLMICDEGHRLKNSAIKTSSILDAVECPRRILLTGTPIQNDLQEF
YSLITFVNPGLLGTYSEFKTKFENPILQSQQPGVLPMFANLGKARLEELNSITSSFILRR
TQEVINKYLPGKQEAVIFCHPSKLQETLLRTAIQFYEKSDRSTYFPLQLITVLKKICNHP
SLIASTEKIDVGGSLIKLLNDNLPPWQDMGPTDSGKLAVLDSLLETLIQRQEKAVIVSYY
GKTLDMIMGLCEHYNYKYCRLDGSTPSQDRCKIVSSFNSPSSDTFIFLLSAKAGGIGLNL
TGASRLILYDNDWNPASDLQAMSRIWRDGQTRNVFIYRLITAFSIEEKIYQRQISKTSLS
GTVVDLKQNLSNLKFSDEELKDLFFFTDDNDDCLTHQMLGCGCGGVGGVPEPTASLNEKE
NVCSPERSKFQIRTAKAKAGKAKHSLQMQELMRWEHYRSPVSERVLKELSLDACSEEIVF
IFRNQVNQREK
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgaagcaaggctccctccatgaaaggactggcaaagccggatttggccacttct
cgccaatcgcacagcttggcgcagaaaataccaatggataaggcggattcagtcgttgcc
aatctgttgcacagcgatgaagatcatgtggacattttgaaacgcttggcggtggaaaag
cacccggctagtatgtcgtcaaaaaccgttacaacgggtaacgattttctcgctaagata
cgatacaaagttgtctggggaaagatcagtaccaagaagcataaaacttgggaaggcgac
ggaacccttgagattctaggacgaacagctactttgaaagacgaggatggaaaaacgatt
gccagctcaacgggattgaagctagactcgattgaggaaggaagccgtctaattgtagga
agtaaagaagttgaattgattgaaaaagcttcagacatcactggaagtgaaacagagaag
cagagttcggaacagattgttccacagcttaagaaagctagggttgaggttttcaagcct
cccgcggtatacgaagaaacaaagaaagcttcgtcaggaagttcgtttaagcaggtcggc
acagttgaagaaattccacctgactttgttccactcgtcatgtcgcaaccaagttttgaa
catcaatggaaatacaaccagaaaaaggcaccactgtccaaagtcacggttccatatgct
ttatccaagcacttgagaccacaccaaagagaaggggtgagttttctttacgaatgcgtt
ttgggtttccgttacacagatgcagatcgatttggagctatattggcggatgagatgggc
ctgggaaagactttgcaatgcatttctctgatatacactctaatgaaacaaggaccatac
agtcaaccgatcttgaagaggatcctcattgtgactcccagcagtctgatggaaaactgg
gacagagaaattagcaaatggcttaaaacggaaagaatcttcacctttatcgtaagtcct
accaatccgttgaagaaatatgctcaatctgcccacattccgatacttataatctcctat
gagctactgtccaaacaaatcagagaactagactcggtcaagtttgatctcatgatatgt
gatgaaggacatcggttgaaaaacagtgccatcaaaacttcatcgatcttggatgcagtc
gaatgccctcggagaatactgctcacgggaacaccaatccagaatgatctccaagagttc
tactccctgattacctttgtgaatccaggccttcttggcacctactccgaattcaaaacg
aagtttgaaaatccaattcttcagtcgcaacaaccaggagtacttccaatgtttgcaaat
cttggcaaagccagactagaagagctgaacagtataacatcttcattcatactgcgccgt
actcaggaagtcattaacaaatacctacctgggaaacaggaagctgtcatattctgccat
ccttccaaattgcaagagacacttcttcgaactgcaatccaattctacgaaaaatccgat
cgaagcacatatttcccacttcaattaatcaccgtgttgaagaaaatctgcaatcatcct
tccctcatcgcgtcaactgaaaaaattgacgttggcggttcgcttatcaagctcctgaac
gataatttgcccccatggcaggacatgggcccaacagattccggtaaactggctgttctg
gactctctactggaaacactgatccaacgtcaggaaaaagctgttatcgtttcatactac
ggcaaaacgctagatatgatcatgggactctgcgaacattacaactacaagtattgtcgc
ttggatggatcaacgccttcccaagaccgctgtaagattgtttccagcttcaacagtccc
tcctcggatacgtttattttcctactaagcgccaaagcaggtggaataggtctcaatcta
actggtgcttctcgcttaatactgtatgataacgattggaatccggcaagtgatctacaa
gccatgtctcgaatctggcgtgatggacaaacacgaaacgtgttcatctaccgactaata
accgctttctccatagaggaaaaaatctatcaacggcagatttcgaaaacgtctctaagc
ggaacagtcgtcgatttgaaacagaacttgagcaatctaaaattttccgacgaggaattg
aaggatttgttcttctttaccgatgacaacgacgattgcctcacccatcagatgttgggc
tgtggttgtggtggcgttggtggtgttcccgagccaacggcaagcttaaacgaaaaagag
aacgtatgctcaccggaacggagcaaatttcaaatcagaacggccaaagcaaaggcggga
aaagcaaaacactcactgcaaatgcaggaactgatgcgatgggaacattaccgaagtcca
gtgagcgaacgtgttttgaaggaattatcgttggatgcgtgctcggaggaaatagtgttc
atatttcgcaatcaagtcaaccagcgggaaaagtag

DBGET integrated database retrieval system