KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002357Help
Entry
AaeL_AAEL002357   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K15293  
protein unc-13
Organism
aag  Aedes aegypti (yellow fever mosquito)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2350 aa AA seqDB search
MDENEVMAAYLWSKQSQDLYASHGLKDLHHLHQDFIINDYTDKIATNIDLLDTELKFAWA
ALNLLNEEYNKMAEKVFKLQSLNLSQQRIVQNLQYMEEHRKAYLDMIPEYAKHHEFSLQE
QSRLQEELQYRDCIDEAYLQHQQQQQMPPYPPYDLGWRYDPATMPEEMAIHDPDYWLMRR
NLSNIPEEQLAQVQAPPRYPQQISTNPFLQSMEAANGGILREIEPASDAAMIEEQLRASF
LNHSQQLELEYGSPMAKQFVAERIEKLRDDDVKQLITRVLDDEDVASLSSEEVEKVRTFM
AKNCSDLREVFAEEFSPLARDTKGGEKLILQNKQSGVSPKKEFNKYIHLPNAEGIASLNN
DDLLTVDNGTISIQDSNGTIDNEFKLNLNMVHPANGFGGVSPKKLIEFSPFGMQKCMLRE
TKESNVFPESMLNKPSFADLMNSKPCAETAMTFTNLNGETESIFSQSFKEAVEAKLAGQA
VQMAGIMINQGEQLPPFPAVPLKPNISEALETAATNGAIEPRRPSVTEAGTVLITPEARR
PSIVDQVLPSLARKPSITTVSDIPRKPSVTEAYEPSMFATVPRRPSAIEPSESSSIFQPI
ARKPSVTETASSPPMFTPLPGQTTITDTPEMQAIYESLSRKSSLPTLGDFFPSLDITDSG
FADSTDGMSLFPTIPLNLSTSDAPVSLPDFSTLSTISNIPETSEASSFVMSMNSSGFSEA
SDSITLPPIVATAESSTTAVISAQLSNQLNQTTAAISKEVLLPPEKISLPPISAAPATIA
ALADSKPIAQATAPPPSTVPTSTTSITADVMKSVKPIVSQAPTTSSPVATQAQVKPVQTT
ASAPVPVSTSAPAPAPTPAPAPIQKPPSQPQQPPQPESKGSGFFQTSTANTNLFGGFFTK
VNKNLAHQDSSDSLISAKSKAFFATMKSSFSLDSSKQSVDEPSQQQPPPSQQQVPPQTTP
PSTATSTSSAGGHQQVSPPAAAEETTTITTTPPLQSPADVAQGQYLHEQKEFSPLQEQFP
SGEHEQSPYGAGSEFPTLNDYSSTTPNAQQEQPYPGDELQGMIEVDGEVPSMPMQRKQSL
FRAQGSEGSMDGEGGSKWKLLKTLKEKRIEEKQKVADAGVEEEEPGLFKKVDVGGKEEPE
KRNGTNESGRGNGVGDNTFYSNIDSMPDIRPRRKSIPLVSELTMLATKRQAAGLTSVVRA
TLNDEELKMHVYKKALQALIYPISSTTPHNFVLWTATSPTYCYECEGLLWGIARQGVRCT
ECAVKCHEKCKDLLNADCLQMCFAGASEKSSKHGAAEDKANSVIAAMKERMKQRERDHPE
IFEVIRKVFNVEEKSHAGHMKAIKQSVLDGTSKWSAKIGITVICAQGLIAKDKSGTSDPY
VTVQVSKVKKRTRTMPQELNPVWNEKFNFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRE
SDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYT
CLHENVFHYLCEEAMGQVNLPQTKGDEGWKIYFDETPEEIVDEFAMRYGIENIYQAMTHF
HCLSTKYLCAGVPAVMSTLLANINAYYAHTTASTAVSASDRFAASNFGKEKFVKLLDQLH
NSLRIDLSMYRNNFPASSQEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVK
ACLRSTYQFLFENCYELYNREFQVDPNEAKREGEDHGPKLENVDFWHKLIALIVSVIEED
KNSYSAVLNQFPQELNIGQVSAATMWSLFAIDMKYALEEHEQHRLCKSSAYMNLHFKVKW
LYTNYVKEVPPYKGAVPEYPAWFEPFVMQWLNENDDVSLEYLHGAFKRDKKDGFQKSSEH
ALFSNSVVDVFTQLTQCFDVVSKLDCPDPEIWKRYMRRFAKTIVKVLLAYVDIVKTEFPD
IMHEERTACILMNNIQQLRVQLEKMFDSMGGDKLEEDAANILKELQQNLNTALDDLATQF
AVSLEPRITGSVRELGDLLQQVKQQTSLFHAPPTDDANIIAMEADEVLRPLMDLLDGSLS
MYAQSCEKTVLKRLLKELWKIVIRTLEKTIVLPPMTDRTMVFKHLTDNAKNLAANAKIED
MSRLFKNHVAGKSDAKNVLSGVMDISKEIEKNLSPKQCAVLEVALDTIQQYFHAGGNGLK
KPFLEKSPELQSLKYALSLYTQTTDTLIKSFVSGQGASEEGGINHDDASVGEVSIQIDVS
SNPENGEQKISVKVIAANDLKWTVPSGMFRPFIEVNLIGPHLNDRKRKFATKSKSNNWSP
KYNESFHFIIGNEEQLEFFELHICVKDYCFAREDRLVGVAILKLKDVVDQVWGWAIVGII
FLLLECSGFE
NT seq 7053 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaaacgaggtgatggcggcgtacctgtggagcaagcagtcccaggacctctat
gctagccatggactcaaggatctgcaccatttgcatcaggacttcatcatcaacgactac
accgataagatcgccaccaacatcgatctgctcgatacggagctcaagttcgcttgggct
gccctcaatctcctgaacgaggagtacaacaagatggcggagaaggtgttcaagttgcag
tcgttgaacctgtcccagcagcgtatcgtgcagaacctgcagtacatggaggagcaccgg
aaggcctacctggatatgattcccgagtacgccaagcatcatgaattctcgctgcaagag
cagtcacgacttcaagaagagctgcagtaccgggattgtatcgacgaggcctatctgcag
caccagcagcagcagcaaatgccgccttatccgccgtacgatcttggatggcgatacgac
ccggcgacgatgcctgaagaaatggccattcacgatccggactactggctgatgcggagg
aacctgtccaacattcccgaagaacagctggcccaagttcaagccccgcctcgatacccg
cagcagatctccaccaatcccttcctccaatcgatggaagccgcaaacggaggaatactt
cgggagatcgaaccggctagcgatgctgcgatgatcgaagagcaactcagggcctctttc
ttgaaccattcccagcagctggagttagagtacggatcaccgatggccaaacagttcgtt
gccgagcggatcgagaagctcagagacgacgacgtgaagcaactgatcacgcgggtgcta
gatgacgaagatgtggcgtcgctgagcagcgaggaggtcgagaaggttagaacgttcatg
gcgaagaactgcagcgatttgcgagaggtgtttgcggaggagttttcaccactggcccgg
gataccaagggtggagagaagttgattctgcagaacaagcaaagtggcgtcagtccgaag
aaggagttcaacaagtacatccatctaccgaacgccgaaggaatagcatcgttgaacaac
gacgatctgctaacggtggacaacgggacaatcagcatccaggatagcaacggaaccatc
gacaacgaatttaagctcaatctgaacatggtccatccagcgaatgggtttggaggtgtt
tcgccaaagaagttgatagaattttcacctttcgggatgcaaaagtgtatgttgcgggag
acgaaggagagtaacgtttttccggagagtatgctgaacaaaccgagtttcgcagacttg
atgaacagtaagccgtgtgcggagactgcgatgacctttacaaacttgaatggggaaacg
gaatcgatatttagccaaagttttaaggaagcggtagaagcgaagctagctggacaagcc
gtacaaatggctggtattatgattaaccagggtgaacagcttccaccgtttccggctgtg
ccattaaaaccgaacattagtgaagctctggaaacggctgctacgaatggagccatcgag
cccaggcgaccaagtgttacggaagcgggtaccgtattgataaccccggaagctcgccga
ccaagcatagtagaccaagtactcccatcattagctaggaaaccaagtataacgaccgtc
tcggacataccacgaaagccgagcgttacggaagcctacgaaccatcaatgtttgcaacg
gttcctcgaaggccaagcgcaatcgaaccgagcgaatcctcatcgatcttccaaccaatt
gcaagaaagccaagtgtaacggaaactgcctcgagccctccgatgttcacaccactacca
gggcaaaccaccatcaccgataccccggaaatgcaagcgatctatgagtcgttgtcgcga
aaatctagtttaccgaccttaggtgacttcttcccgtcgctggacatcaccgactctggt
ttcgctgactctaccgacggaatgtccctgtttccaactattccgttgaatctgtcgacg
tcggacgcacccgttagtttaccggatttctctaccctatcgacgatttccaacattccg
gaaacatcggaagcgtcctcgttcgttatgtctatgaactcgtccggattcagcgaagca
tcggacagtatcacgcttccaccgatagtagctacagccgaatcgagcacgactgccgta
atatcagcccagctgtcaaatcaactcaatcaaaccaccgcagccatatcgaaggaagtc
ctcctaccgccggagaagatatctttaccacccatatcagcagctcccgcaacgatagct
gccctagcggatagcaaaccgatcgcccaagcgacagcacctcccccttcgaccgttcca
acatcaaccacttcgatcactgcggatgtgatgaagtcggtgaaacccattgttagtcaa
gcgcctacaacgtcctctccagtcgcaacccaagcccaagttaaaccggtacagacaacg
gcatcagcgcctgtccccgtttccacttcagctccggcaccagcaccaacaccagctcct
gcgcctattcagaagccaccctctcaaccccagcaaccgccacaaccggaatccaagggc
agtggcttctttcaaacctccaccgccaacaccaacctcttcgggggcttcttcaccaaa
gtcaacaagaacctcgcacatcaggacagttccgacagtctaatcagcgccaaatccaaa
gcgttcttcgccaccatgaaaagctccttctcgctcgactccagcaagcaatccgttgac
gaaccgtcgcaacagcagccacctccatcgcagcagcaggttcctccgcagacgacgcca
ccttcgacggccacgtccacctcgagtgccggcggccaccagcaggtatcgccaccggcc
gcagcagaagaaacaaccaccatcaccactactccacccctacaatctccagcagatgta
gcgcagggtcagtacctgcacgaacagaaggagttttcccccttgcaagaacagttcccg
agcggcgagcatgaacagtccccgtacggagcgggttcggagtttccgacactcaacgac
tacagcagcacaacgccgaacgcacaacaggaacagccgtacccgggagacgaactgcaa
gggatgatcgaagtcgacggtgaagtgccgagcatgccgatgcagcggaagcagagcttg
tttcgtgcacagggaagtgaaggatcgatggatggtgaaggtggtagcaagtggaaactg
ctcaaaacgttgaaggagaagcgaatcgaggagaaacagaaggtagcggatgctggcgtc
gaggaagaggaaccgggtctgttcaagaaggtcgacgtaggtggtaaggaagaaccggag
aagcgcaacggaactaacgagagtggacgaggaaatggagtgggagacaatactttttac
agcaacatcgacagtatgccggatattcgtccccggcggaagtcgatcccattggtgtcg
gaattgacgatgttggctacgaaacgccaagcagctggacttacatcggttgtacgggcc
accttgaatgacgaagaactgaaaatgcatgtctacaagaaggccctacaggcgttgatc
tacccgatctcgtcgacaaccccgcacaacttcgtcctgtggacggcaacttccccgacg
tactgttacgagtgcgaaggactgctgtggggtatcgcccgccaaggtgtcagatgtacg
gaatgtgccgtcaagtgccacgagaagtgcaaggacctgttgaacgccgattgcctacag
atgtgctttgcgggtgcttccgagaagagttccaagcatggtgccgccgaagataaggca
aattctgtgatcgcagcgatgaaggaacggatgaagcaacgggaacgggaccacccggag
atcttcgaggtgatccggaaggtgttcaacgtggaggagaagagccacgcaggtcacatg
aaggcgatcaagcagagcgtactggacggtacgagcaagtggtctgccaagatcggcatc
actgtgatctgcgctcagggtttgatcgcgaaggacaagagcggtaccagcgatccgtac
gttaccgttcaggtcagcaaggtcaagaagcgaacgcgcacgatgccgcaggagctgaac
ccggtgtggaatgagaagtttaactttgagtgccacaattcttccgatcgtatcaaggtc
cgcgtctgggacgaggacaacgatctgaagtcgaaactgcgccagaagttgacccgcgaa
tcggacgactttctgggacagacaatcatcgaggtgcgaacgctttcgggcgagatggac
gtgtggtacaatctggagaagcgaacggacaaatcagcggtgtcgggtgcgattcggttg
cacatttcggtggaaatcaagggcgaggagaaggtcgctccgtaccacgtgcagtacacc
tgtctgcacgagaacgtgttccactatctgtgcgaagaggcaatggggcaggtcaatctt
ccgcaaacaaaaggcgacgaagggtggaagatctactttgacgagacgcccgaggagata
gtggacgagttcgccatgcggtatggcatcgagaacatctaccaggccatgacgcacttc
cattgcctatcgaccaagtacctgtgcgcgggcgtcccggcagtgatgagtaccttacta
gcgaacattaacgcttactacgcacacacgacggcttcgaccgctgtatcggccagcgat
cgcttcgctgctagcaactttggcaaggagaaattcgttaaactacttgaccagctgcac
aactctctccgtattgatctatcgatgtatcgcaacaacttccccgcttccagccaagag
aaactgatggatctcaagtccacggtcgatctgctaaccagtattacatttttccgcatg
aaggtgcaagaattgtcgagcccacctagagctagtactgtagttaaggactgcgttaag
gcttgtctacgctcaacgtatcagtttttgttcgagaattgttatgagttgtataatcga
gaatttcaggtcgaccccaacgaagcgaaacgtgagggcgaagaccatggaccaaaatta
gagaatgttgacttttggcacaaactaatcgcacttatcgtatcagtaatagaggaagat
aagaatagttatagcgcagtgcttaatcaatttccacaggagcttaatatagggcaggtc
tcggctgcaacgatgtggagtctgttcgcaatagatatgaagtacgcactggaagagcac
gaacagcaccgcctgtgtaaatcatccgcctacatgaacctgcacttcaaggtcaagtgg
ctgtatacgaactacgtaaaggaggtaccgccgtacaagggcgccgtgccggagtacccg
gcctggttcgagccgtttgtaatgcagtggctcaacgagaacgacgacgtatcgcttgag
tacctgcatggtgccttcaagcgtgacaagaaggacgggttccaaaagagcagtgagcac
gcactgttctccaactcggtcgtggacgtgttcacacagttaacgcagtgcttcgatgta
gttagcaaactggactgcccggatccggagatctggaagcggtacatgcgacgattcgcc
aaaactattgtgaaagtgttgctcgcttacgtagatatagtaaaaaccgaatttcccgat
atcatgcatgaggagaggacggcttgtattctgatgaacaatatccaacaacttcgggtc
caattggagaagatgttcgattcgatgggtggtgacaagctggaggaagatgcggccaac
atcttgaaggaactgcagcagaatctaaacaccgcattagacgatctggctacgcagttc
gccgtcagcttggaaccacgcataaccggtagcgtacgggaactgggagatctgctgcag
caagtcaagcagcagacttccctgttccacgcaccacccaccgacgatgccaacataatc
gccatggaggcggacgaagtccttcggccgctgatggatctgctggacggatcgctctca
atgtacgcccaatcatgcgagaagactgtgctcaagcgattgctcaaggaactgtggaag
attgtcatccggacgctggagaagaccatcgtgctgccgccgatgacggaccgaacgatg
gtcttcaaacatctcacggacaacgccaagaacctggcggccaacgccaagatcgaagac
atgtccaggctgttcaagaatcacgtggcaggcaagtcggacgccaagaacgtactcagc
ggggtgatggatatttccaaggagatcgaaaagaatctctcgccgaagcagtgcgccgtt
cttgaagtggcccttgacaccatccagcagtacttccacgccggtggcaatggactgaag
aagccgttcctggagaaatcgcccgagctgcagagcctgaagtacgctctgagtctgtac
acgcagacgacggatacgctgatcaagtcgttcgtctccggacaaggggcatcggaagag
ggtggaatcaaccatgacgatgcttccgtcggggaggtttcgattcaaatcgacgtctcg
tccaatccggagaacggcgaacagaagatatccgtcaaagtaatcgccgccaacgatctg
aagtggaccgtcccgtccggaatgttccggccgttcatcgaggtgaacctgatcgggccg
cacctgaacgaccggaagcgcaagttcgccaccaaatccaaatccaacaactggtcaccg
aagtacaatgagtcgttccatttcatcattggcaacgaggagcagttggagttcttcgag
ttgcacatctgcgtcaaagattactgctttgctcgtgaggatcgcctggtgggggtcgca
atcctgaagctgaaggacgtagtcgatcaggtatggggatgggcgattgttgggatcatt
tttctgttgttggaatgttcgggatttgagtga

DBGET integrated database retrieval system