KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002542Help
Entry
AaeL_AAEL002542   CDS       T01053                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AaeL_AAEL002542
   01230 Biosynthesis of amino acids
    AaeL_AAEL002542
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AaeL_AAEL002542
   00051 Fructose and mannose metabolism
    AaeL_AAEL002542
   00562 Inositol phosphate metabolism
    AaeL_AAEL002542
Enzymes [BR:aag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AaeL_AAEL002542
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AaeL_AAEL002542
  Exosomal proteins of bladder cancer cells
   AaeL_AAEL002542
  Exosomal proteins of melanoma cells
   AaeL_AAEL002542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 247 aa AA seqDB search
MGRKFCVGGNWKMNGDKASITDLCKTLTTGPLSADTEVIVGCPAPYLTLARSQLPDSVGV
AAQNCYKVAKGAFTGEISPAMLKDLNIGWVILGHSERRAIFGESDELVADKVAHALAEGL
KVIACIGETLQEREAGQTEAVCFRQTKAIADKVKDWSNVVIAYEPVWAIGTGKTATPEQA
QEVHAALRKWFTENVSADVSGAIRIQYGGSVTAANCRELAAKPDIDGFLVGGASLKPEFI
QIVNARQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaaattctgcgtcggaggaaactggaagatgaatggtgataaggccagcatc
accgatctgtgcaagaccttgaccactggaccgctgagtgccgacaccgaggtcatcgtc
ggatgcccagccccctatctgaccttggctcgctcccagctgccggacagcgttggagtc
gccgcccagaactgctacaaggtggccaagggtgccttcaccggtgaaatttcgccggcc
atgctgaaggacttgaacattggctgggtcatcctgggacattcggagcgtcgtgccatt
ttcggtgaatcggacgaactggtggccgataaggtcgcgcacgctttggccgaaggtctg
aaggtcatcgcttgtatcggcgaaacgctgcaggaacgtgaagccggtcaaaccgaggcc
gtgtgcttccgccagaccaaggccatcgccgataaggtcaaggactggagcaacgttgtg
attgcttacgaaccggtctgggctattggtaccggtaagactgccaccccggaacaggcc
caggaagtgcacgctgccctgaggaagtggttcaccgagaatgtgtccgccgatgtttct
ggagcaatccgaatccagtacggaggatcggtcactgctgccaactgtcgtgaattggcc
gccaagcccgacatcgatggtttcctggttggtggtgcttcgttgaagccggagttcatt
cagatcgttaatgctaggcagtaa

DBGET integrated database retrieval system