KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002562Help
Entry
AaeL_AAEL002562   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:aag00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AaeL_AAEL002562
   03008 Ribosome biogenesis in eukaryotes
    AaeL_AAEL002562
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     AaeL_AAEL002562
Ribosome biogenesis [BR:aag03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     AaeL_AAEL002562
Transfer RNA biogenesis [BR:aag03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    AaeL_AAEL002562
Mitochondrial biogenesis [BR:aag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    AaeL_AAEL002562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 178 aa AA seqDB search
MSEGKHVPGQENVAVKLASSTSGKRSNKTKPHSGAAPTSSSADQKPQTGGRKFSDRHIVK
KRVLPKYYTRENDIYVTVKSDFTFQYKRCLDILNSALGEAFLHCTGRAINQGINLALKIK
AKYPEAFDYEVNTSTITVTDDLHPLKDDDDFSEQRRMNSCLHIRLYRTIQLKPTNSAA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaggaaaacatgtccccggacaggaaaatgtcgctgtaaaattagcatccagc
accagcggcaagaggagcaacaaaaccaaaccccattccggtgcggctccaacatcgtct
tcggcagaccagaaaccgcaaaccggaggaaggaaattcagtgaccggcacatcgtaaag
aaacgcgtcctgccgaagtattacacacgggaaaacgacatctacgtgaccgtcaaatcg
gattttacgttccaatacaaaaggtgcttggatatcttgaattctgccttgggagaagca
tttttgcactgtactggaagggccatcaatcaaggaatcaatctcgcgctcaagataaag
gcaaaatatccagaagcattcgactacgaggtcaatacttctacgataacggttacagac
gatcttcatcctctgaaggacgacgatgatttcagcgaacaacgccgcatgaactcgtgt
ctgcacatccgtctgtaccgtacgatccaactcaagccaaccaactcagccgcctaa

DBGET integrated database retrieval system