KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002562Help
Entry
AaeL_AAEL002562   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:aag03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:aag03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 178 aa AA seqDB search
MSEGKHVPGQENVAVKLASSTSGKRSNKTKPHSGAAPTSSSADQKPQTGGRKFSDRHIVK
KRVLPKYYTRENDIYVTVKSDFTFQYKRCLDILNSALGEAFLHCTGRAINQGINLALKIK
AKYPEAFDYEVNTSTITVTDDLHPLKDDDDFSEQRRMNSCLHIRLYRTIQLKPTNSAA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaggaaaacatgtccccggacaggaaaatgtcgctgtaaaattagcatccagc
accagcggcaagaggagcaacaaaaccaaaccccattccggtgcggctccaacatcgtct
tcggcagaccagaaaccgcaaaccggaggaaggaaattcagtgaccggcacatcgtaaag
aaacgcgtcctgccgaagtattacacacgggaaaacgacatctacgtgaccgtcaaatcg
gattttacgttccaatacaaaaggtgcttggatatcttgaattctgccttgggagaagca
tttttgcactgtactggaagggccatcaatcaaggaatcaatctcgcgctcaagataaag
gcaaaatatccagaagcattcgactacgaggtcaatacttctacgataacggttacagac
gatcttcatcctctgaaggacgacgatgatttcagcgaacaacgccgcatgaactcgtgt
ctgcacatccgtctgtaccgtacgatccaactcaagccaaccaactcagccgcctaa

DBGET integrated database retrieval system