KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002761Help
Entry
AaeL_AAEL002761   CDS       T01053                                 

Definition
tropomyosin invertebrate
Orthology
K10373  
tropomyosin 1
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   AaeL_AAEL002761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 271 aa AA seqDB search
MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT
QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA
DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE
ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE
FAERSVQKLQKEVDRLEDDLDTAFVELILKE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaagaagatgcaggcgatgaagctggagaaggacaacgcgttggat
cgcgcccttctctgcgaacagcaggcccgcgacgccaacctgcgcgcggaaaaggccgaa
gaagaggcccgccagctgcagaagaagatccaggctattgaaaatgacctcgatcagacc
caggaggcgctgatggccgtcaacgccaagctggaggagaaggagaaggctctccagaac
gccgaatccgaagtcgctgccctgaaccgtcgtattcagctgttggaggaagatctggaa
cgttcggaagaacgtctggcttccgccacggctaaactgtcagaggcttcggcggctgct
gatgagagcgaacgtgcacgcaaggttcttgagaaccgtgccctggccgatgaagagcgt
atggatgctcttgagaaccagctgaaggaagcccgcttcatggctgaggaagctgacaag
aaatacgatgaggtcgctcgtaaattggccatggttgaagccgatctggagcgcgctgaa
gagcgcgccgaagccggtgaaggcaagatcgtcgagcttgaggaggagctgcgcgttgtc
ggtaacaacctgaagtcgctggaagtctcagaagaaaaggctaaccaacgtgaagaggag
tacaagaaccagatcaagaccctcactacccgtctaaaggaggctgaagctcgtgctgaa
ttcgctgaacgttccgttcagaagttgcagaaggaagtcgacagactcgaggacgacctg
gacaccgccttcgtcgaactcatcctcaaggaatag

DBGET integrated database retrieval system