KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002764Help
Entry
AaeL_AAEL002764   CDS       T01053                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AaeL_AAEL002764
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AaeL_AAEL002764
  Amino acid metabolism
   00310 Lysine degradation
    AaeL_AAEL002764
Enzymes [BR:aag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AaeL_AAEL002764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
AA seq 491 aa AA seqDB search
MAGLLSISSRNLPRTALRISGGLRSLEAGSQQITNNGLRSYHQGRAALQRLVRATAAESA
PIQSSTAASNAASRWLQTERSIFTSSRLLNSEVVKVPPFADSVSEGDVKFEKKVGDAVAA
DEVVMEIETDKTTVGVPAPAHGIIEEIYVADGDTVKAGQQLFKLKITGEAPAASAPKAEA
AAPAAAAPPPPPPPPVAAAAASAPPPPPPAAAAAPPPPPPKPTGPITKMPVAAMRHAQAI
DAATVKLPPADYTKEITGTRTEQRVKMTRMRLKIASRLKEAQNTNAMLTTFNEIDMSFIM
DFRKQHLEAFQKKYGMKLGFMSAFCKAAAYALQDQPVVNAVIGENEIIYRDYVDISVAVA
SPKGLVVPVLRNVEGMNFADIELAIAGLADKAKKGTLAVEDMDGGTFTISNGGVFGSLLG
TPIINPPQSAILGMHGIFERPIAVKGQVVVRPMMYVALTYDHRLIDGREAVTFLRKIKAA
VEDPRIILAGL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggctggattgctgtcaatctcgtcgcgtaatcttccgcgaaccgcacttcgtatcagc
ggtggccttcgttccctggaagcgggctcacagcagattaccaacaatggtttgcgttcc
tatcaccaggggcgcgctgccctgcagagattagtccgggcgacagccgccgaaagcgca
ccgatccaaagctcgacagccgcctctaacgctgcctcccgatggctgcaaaccgaacgc
agcatcttcacctcctcccggttgctcaactcggaggtcgtcaaggtgcccccgttcgcc
gattccgtatcggaaggtgacgtcaagttcgaaaagaaggtcggtgatgctgtagccgcc
gacgaagtggtcatggaaatcgaaaccgacaagaccacggtgggagtaccggccccagcc
cacggtatcattgaggagatctacgtagccgacggtgacaccgtcaaggccggccagcag
ttgttcaagctgaaaatcaccggagaagctccggcagctagtgcaccgaaggccgaagct
gcggcacctgctgcagcagcaccgccacctccgccaccaccaccggtagccgctgcagca
gcttctgcacctccaccgccaccaccggccgcggcagccgctcctccacctccgccaccg
aaaccgactggccccattactaaaatgcctgttgctgccatgcgtcacgcacaagccatc
gacgccgccacggtcaaactgcctccggccgattacaccaaggaaatcaccggcaccagg
accgagcagcgcgtcaagatgacccgcatgcggctgaagatcgcgtcccgactaaaggaa
gcccaaaacaccaacgccatgctgaccacgttcaacgaaatcgatatgagcttcatcatg
gacttccgcaagcaacacttagaagccttccagaagaagtacggcatgaagctgggcttc
atgtctgccttctgcaaagcagctgcctacgcattacaggaccaacccgtagtgaatgcg
gttatcggagaaaacgaaatcatctatcgcgactatgtcgatatttcggtcgcagtggcg
tcgcccaagggtctggtcgtgcctgtgctaaggaatgtcgaaggtatgaactttgcggac
attgaactggccatcgccggcctggcagacaaggccaagaagggcacattggctgtggaa
gacatggacggcggtaccttcaccatctcgaacggtggagtgttcggctcgctacttggc
acacccatcatcaaccccccgcaaagtgccatcctgggcatgcacggaatcttcgaacgg
cccatcgccgtaaaaggacaggttgtcgtgcgaccgatgatgtacgttgcgctgacttac
gatcaccgactgattgatggccgtgaggctgtgactttcctgcgcaagatcaaggccgcc
gtcgaggatccccgcatcatcttggctggactgtaa

DBGET integrated database retrieval system