KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002779Help
Entry
AaeL_AAEL002779   CDS       T01053                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AaeL_AAEL002779
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AaeL_AAEL002779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 320 aa AA seqDB search
MSGKFDVVVFGSLIVDFISYVPRLPKVGETLHGTKFTTGFGGKGANQCVAAARLGSRTAM
IGKLGNDPWGKNYYSNLQKEGVNIDHIAILDGQSTGIAQINVANNGDNQIVIVVGANNCL
QVDDVQACGELLSEAKVLVCQLETPVLATIEALKTFKGTSIMNAAPALENIPLALLKCCT
IFCVNESEAALITGMPVETIAEAKGALFKLRDMGCGTIIITLGEKGAIFVTKDCTKVIHV
KPFKVDNVVDTTGAGDAFIGALAHFIAEDPTAEMAQCVAAASQVAALSVQKPGTQTSFPR
MEETGLTGLSSSSLSEWEYI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaagtttgatgttgttgtgttcggttcgctaatcgtggacttcataagctac
gttccacgtctaccgaaggtgggtgaaacgctacatggaacgaaatttaccaccggtttc
ggtgggaaaggagcgaatcaatgcgtagctgctgctcgtttgggcagccggactgcaatg
attggaaaactaggaaacgatccgtggggcaaaaattactacagtaacctccagaaggag
ggggtcaatatagatcacattgccattctggatggacaaagtaccggaattgcgcagatc
aatgttgctaataatggtgataaccaaatagtgatagtcgtcggagcgaacaactgtttg
caggtggatgatgtccaagcctgcggagaattactcagtgaagctaaagtcttggtatgc
cagcttgaaactcccgtcttagcaacgattgaagcgttgaaaacgttcaaaggtacatcc
ataatgaatgcagctccggctttggaaaacattcccctagcgctactcaaatgctgcact
atattttgtgtcaacgaatccgaagcagccctcataaccggaatgccggttgagacaatt
gcggaagcaaaaggcgcattgttcaaattgcgggatatgggctgtggtacgattatcatc
accctcggcgaaaaaggggcgatttttgtgacgaaagactgcacaaaggtcattcacgta
aaaccattcaaggtcgataatgtcgtggatacaacgggagccggcgatgcatttataggt
gccctggcacatttcatagcagaggatccgactgcagagatggcccagtgcgtagcggca
gccagtcaagtagcggctttatcggtgcaaaaaccaggcacccagacgagctttccgcgc
atggaagaaaccggacttacaggattgtcatcatctagtttaagtgaatgggaatacatt
taa

DBGET integrated database retrieval system