KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002796Help
Entry
AaeL_AAEL002796   CDS       T01053                                 

Definition
l-asparaginase i
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AaeL_AAEL002796
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     AaeL_AAEL002796
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     AaeL_AAEL002796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 728 aa AA seqDB search
MYFRSPIIQANIISLISRPIEMSNPSPQVDSTVRNASDSEDEGGLVMRIASATSTSTATN
NNSASNGSFSKNGTSINGNNGFQNTPWKRKQLVDVTPSGSLDLSKLSMRRNSSYGKLPSE
NPEAKVLVIYTGGTIGMMRNEKNALEPRPNEFVRKIRQYPNMHDDAYASKRYGPARNMAP
LVLPYVEGEHRRILYQICEYEPLLDSSNMGVADWVRIANDIKQSYEFFDGFVVLHGTDTL
CYTASALSFMFENLGKTVILTGSQIPIFETRTDGKDNFTSALIMAGNYVIPEVCVFFNSR
LFRGNRTIKVSSGSLDAFNSPNAAPLAKMGINVEVDYRLIFRPCTVEKFNVHVHMDENVG
LLRVFPSISMTTVKAFLQPPMRGVVLQTYGAGNLPTNRPDLLEALRDAANREVLIVNCTQ
CTEGAVSDLYETGRQLQDIGVIPGFDMTPEAALVKLSYVISKADWNYETKKLMLKNNLRG
ELTHEKTPEMQEYDLIDAVARTLQLNSDKELIQLKSSLFPAMVNSAVLAGDVPKINNIKG
YGANLSAENYDRRTALHVACCEGNLEVVQYLLQNGAAVHIRDRYDRTPLMDAILNDHYEI
IRLLLKCGAHLTGSIRAIGESLCSAAARNLLHRLESYRIAGADLSQADPSGRTALHVAAM
YGNLDVTQYLVKYYAEVNAVDYLGLTPLDYAVKVNAQPVIAFLLEKNAKRGADMEEIPLP
DFQESFEY
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtatttccgaagcccaataattcaagctaatatcatttcccttatttccagacccatc
gaaatgtccaatccgtcacctcaggtggacagcaccgtccggaatgcttccgacagcgaa
gacgaaggaggcctggtgatgcgaatcgcctcggccacgtccacgtccacagccaccaac
aacaacagcgcttcgaacggatcgttctccaagaacggaacgtccatcaatggtaacaac
ggcttccaaaacaccccttggaagcgcaaacagctcgttgacgtcacgcccagcgggagt
ctcgacctgagtaagctctcgatgcggcggaattccagctacgggaaactcccgtcggag
aacccggaggccaaggtgctggtcatctacaccggcggaacgatcggcatgatgcgcaac
gagaagaacgcgctggaaccgaggccaaacgagttcgtccgcaagattcgtcaatacccg
aacatgcacgatgatgcgtatgcttccaagcgatacggccctgctaggaacatggccccg
ttggtgcttccatacgtggaaggcgaacatcggcggattctgtaccaaatctgcgagtac
gaaccgctgctggactcgtccaacatgggcgtggccgattgggtccggatcgccaacgac
atcaagcagtcgtacgagttcttcgacggattcgtagtgctgcacggtaccgatacgctg
tgctacacggcttcggccctgtcctttatgtttgagaatctcggaaagacggtgatcttg
actggatcgcaaatacccatttttgaaacgcgaactgacgggaaggacaatttcacgtcg
gccttgatcatggcggggaactacgtcatccctgaggtgtgcgtattcttcaacagtcga
ctgttcagaggtaatcggacgatcaaggtgagtagcggatcgttggatgcgttcaactcg
ccgaatgctgcgcccctggcaaagatggggatcaacgtggaggtcgactaccggttgatc
ttccgaccttgcacggtggagaagttcaacgtgcatgtccacatggacgaaaacgtgggc
ctgttgcgagtgtttcccagtatttcgatgactacggtgaaggcgttccttcaacctccg
atgcgaggcgtcgttctccagacttacggagccgggaatctcccgacgaatcgtccggat
ctgctggaagcactgcgtgacgcagctaatcgcgaagtcctcatcgtcaactgcactcag
tgcaccgaaggagcggtcagcgatctctacgagaccggtagacagcttcaggacatcgga
gtcatacccgggttcgacatgacgccggaggccgccctggtcaagttgtcgtacgtgatc
agcaaagctgattggaattatgagactaagaagttgatgttgaagaacaaccttcgcgga
gagttgacccacgagaagaccccggagatgcaagagtacgatctgatcgacgcggtcgct
cgaactctccagctgaattcggacaaggagctgatccagctgaagtcttcccttttcccc
gctatggtcaacagtgccgtcctggccggagacgttcccaagatcaacaacatcaagggc
tacggagcgaacttgtccgcggaaaactacgatcggagaacggccttgcatgtcgcctgc
tgcgagggcaacctggaagtcgtccagtatctgctccagaacggagccgccgtacacatt
cgcgatcgctacgatcgcacaccgctgatggatgcgatcctcaacgatcattacgagatc
attcggctgttgctgaaatgtggtgctcacttgaccggatcaatccgggcgatcggtgag
agcctgtgcagtgcagcggccaggaatctgctgcaccgactggagtcctaccgtatcgcc
ggagccgatctttcccaggccgatcccagcggtcgaaccgctctgcacgtggcagccatg
tacggaaacctcgatgtgacccagtatctcgtcaagtactatgccgaagtcaacgccgta
gactacctgggcctgacgcccctggactacgccgtcaaagttaacgcacaacctgtgatc
gctttcctgctggagaagaacgctaagcgtggcgcagatatggaagagatacccttaccc
gatttccaagaatcattcgaatactag

DBGET integrated database retrieval system