KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL002903Help
Entry
AaeL_AAEL002903   CDS       T01053                                 

Definition
phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aag00562]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:aag04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aag04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:aag04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aag04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 1055 aa AA seqDB search
MVMMFNYDYWANPEEHADITFFLPNGVLIILNYSIYTTLQDLKADVWEEAERYPLYCHLG
DKSMYFFSTISSANNNSYELNDESKRLIDIQPVFNMFRFVEKQVSVNNKLINNITNLLGK
TLSEKTLKNPEVNDFRTKMSYLCEDIANKRANMNRMQRIAYQYPPKLVSCEHIPEVVKKR
MINGGDFCVVARCSDIAVTVKIPCKATPNEVIKRILDKKQILANTRNENSSEFILKVCGR
EEYLFGDHPIINFQYVQDSLSREETPTFVPKLLRNVDIFEDNIYEIPEDITQRTNSTGSR
QPAHTLRKVKYVPSWDTEGTFMCMVKEINALNCDSNRNVEVGITLGLFHGGKSLCKPMKT
ELVALNGGRAVWNETIVFDIDVKNVPRMARLCLVIYELVRTAKGSGVRARRTKDGFMNPI
AWVNTMLYDYKSQLKSGPVTLYTWTYAEDLQSEDVLHPLGTVEPNPRRDECSSIILSFHS
YYNEHKIVVYPSEEQLLDHASKMRKINRHLNRDSAEEVRPIKEILLPYMHNDKLNDMHEQ
DRNAIWAKRRECMTLEPDGLPCLLYCVEWNDRNEVAEIVSLLQEWPILPVERALELLDYA
YADQYVRRYAVKCLRTIQDDELLLYLLQLVQAMKHESYIYSDLVDFLLQRSLNNQHIGHF
FFWHLRSEILVPSVQVRFSLILEAYLKGSQEHISILLKQMQCLRKLQHGSELVKKGNKEK
GKSLLMDYLQDKPVGDALSDVISPLNPSFRCKTVRKEKCKVMDSKMRPLWIVYQNSDSNG
DDINMIFKNGDDLRQDMLTLQMLRIMDRIWKSHGYDFRMNPYSCISTDRRLGIIEVVLNA
ETIANIQKERGMFSATSPFKKGSLLTWLKEHNTTEEMLAKAIQEFTLSCAGYCVATYVLG
VGDRHSDNIMVKKTGQLFHIDFGHILGHFKEKFGFRRERVPFVLTHDFVYVINNGRTDRE
AKEFRQFQHLCEEAFLILRKHGCLILSLFAMMISTGLPELSSEKDLNYLRETLVLDLPEE
DARTHFKSKFSEALANSWKTSLNWASHNFSKNNKQ
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgatgttcaactacgattactgggcgaacccggaggagcacgccgacataacg
ttctttctgccaaacggtgtgctcatcatactgaattattcaatttacacaacactgcag
gatcttaaggcggatgtctgggaagaggctgagcgctaccccctgtactgtcacctcggt
gacaagtcgatgtacttcttcagtacaatatcgagcgccaacaacaacagctacgagctg
aacgatgagtccaaacggctgatcgacatccagcctgtgttcaacatgttccgcttcgtg
gagaagcaggtttccgtgaacaacaagctcatcaacaacatcaccaatctgctggggaaa
accctgtcggaaaagaccctgaaaaatccggaggtcaacgactttcgcaccaaaatgagc
tatctgtgcgaggacattgccaacaagcgcgccaacatgaatcggatgcagcggatagcc
tatcagtatcctcccaagttggtcagctgtgagcacataccggaggtggtgaagaaacgc
atgatcaacggtggggacttttgcgtggtggccagatgttccgatattgctgtcaccgta
aagattccctgcaaagcaacgccgaacgaagtgataaagcgcattttggataagaagcaa
atcctggcgaatacgcgaaatgagaacagttcggagtttatattgaaggtttgtggccgg
gaggaatatctgttcggtgatcacccgattatcaacttccagtacgttcaggattcgttg
tcccgcgaagaaacgccaacatttgttcccaagttacttcgcaatgtggatattttcgaa
gataatatttacgaaatcccggaggatataacccaaaggacaaacagtaccggcagtagg
caacctgcgcacactttgcggaaggtgaaatacgttcctagctgggatacggaaggcaca
ttcatgtgcatggtgaaagaaatcaacgccctgaactgtgactcgaatcgcaatgtggag
gttggcatcacgctcgggttgtttcacggaggaaaatctctttgtaaaccgatgaaaacg
gaattggtggcgctaaatggaggtcgtgcggtgtggaatgaaacgatagttttcgatatt
gatgtaaaaaatgttcctaggatggcgcggttatgtttagtaatttatgaactggtcagg
acggcgaagggttccggcgtgagggcccgccgcaccaaggatgggtttatgaatcccatt
gcttgggtgaacaccatgctgtacgattacaaaagtcagctcaaatccggcccggtaacg
ttgtacacgtggacctatgcggaagatttgcaatcggaggacgtgctgcatccactcggt
acagtggaaccgaacccgcgacgggacgaatgttcctcgataattttaagttttcacagc
tactacaatgaacacaagatcgtggtgtatccttcggaggagcagctgctggaccatgcc
agcaagatgcgaaagatcaataggcatttaaaccgtgacagtgcggaggaggtgcgacct
atcaaggagattctgctgccgtacatgcacaacgataagctgaacgatatgcacgaacag
gatcgtaatgcgatttgggcgaagcggagagagtgcatgacgctggaaccggacgggttg
ccgtgtttgctctactgcgtggagtggaacgacaggaatgaggtagcggaaatcgtctcc
ctgctgcaggagtggcccatccttccggtggagcgtgccctcgagctgctcgactacgcc
tacgccgaccagtacgtccggcgctatgccgtcaagtgtttgcgcaccatccaagacgac
gaactactcctctacctgctgcagctggtgcaagccatgaagcacgaatcctacatctac
agcgatctggtagatttcctcctgcagcgatccctcaacaaccagcacattgggcacttc
ttcttctggcatttacgatcggaaatcctggttccctcggtccaagtgcggttcagcctt
atcctcgaagcatacttgaagggcagtcaggaacatatatcgatactgctgaagcagatg
cagtgtttgcggaagcttcaacatgggtccgagttggtcaagaaaggcaacaaggaaaag
gggaaatctctgctgatggactaccttcaggacaaacccgtcggcgatgcattgtccgac
gtaataagtccgcttaatcctagctttcgctgtaagaccgttcgcaaagaaaagtgcaaa
gtgatggattccaagatgcgacccctatggattgtgtaccaaaattccgatagcaatggc
gacgatattaacatgatctttaaaaacggcgatgatctccggcaggatatgctgacgcta
caaatgcttcgaattatggatcgaatatggaaaagtcacgggtatgatttccgaatgaat
ccctacagttgcataagcaccgaccggcggttaggcatcatcgaggtggtgctcaatgcg
gaaaccattgccaacatccagaaggaacgagggatgttctcggccacttcgccgttcaag
aagggatcgcttctgacgtggctcaaggaacacaacaccacggaggaaatgctagcgaaa
gcaatacaggaattcacgctcagctgtgccgggtactgtgtggcaacttacgtgctgggg
gtgggcgatcggcattccgataatatcatggtgaaaaagactggtcagctgttccacatc
gacttcggtcacatattgggccatttcaaggagaagttcggttttaggcgcgagcgagtt
ccgttcgtgttaacgcacgactttgtgtatgtgatcaacaatggacggaccgatcgggaa
gctaaggagtttcgacagttccagcatctttgcgaagaggcattcctaatcctacgaaag
cacggatgtctaatcctatcactgttcgccatgatgatctcgaccggtttgccggagctg
tcttcggagaaggatctcaactatctgcgggaaactttggtactggatctgccagaggag
gacgcccgcacccacttcaagtccaaattcagcgaagccctggccaactcgtggaaaacg
tccctcaactgggcctcgcacaatttctccaagaacaacaaacagtga

DBGET integrated database retrieval system