KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003013Help
Entry
AaeL_AAEL003013   CDS       T01053                                 

Definition
dual specificity mitogen-activated protein kinase kinase 4 MAPKK4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AaeL_AAEL003013
Protein kinases [BR:aag01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AaeL_AAEL003013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 391 aa AA seqDB search
MADQTNQNSTQEPMRTRFLPLDMNNANCDRKRPSKKLSFQPSPVVTARTPPLSDRTRDRI
KMQATGKLQIAPNAIYDFTADDLTDEGEIGRGAFGAVNQMKFNRTDTVMAVKRIRSTVDE
KEQKQLLMDLEVVMKSNDCNTIVTFYGALFKEGDCWICMELMDTSLDKFYKFICDCQHSR
IPEPILGQITLATVRALNYLKEELKIIHRDVKPSNILLKRNGDIKLCDFGISGQLVDSIA
RTKDAGCRPYMAPERIDPQRAKGYDVRSDVWSLGITLMEVATGKFPYPKWGSVFEQLSQV
VEGDPPRLSQSYNNMEFSLDFVNFVNTCLIKDEKDRPKYGKLLQHPFIQRADKSHTDVSV
YVSAILESMANNGITQFTTNLPAERWSDSFN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaaacaaatcagaattccacacaggaaccaatgcgaacgagattcctgccg
ctggacatgaacaatgccaactgtgaccggaagcgaccatcaaagaagctgagctttcag
ccgagcccagtggtcacggcacgaaccccgcccctgtcggaccgtacgagggaccgcata
aagatgcaagcaacggggaagctacagatagcacctaatgccatttacgatttcactgcc
gatgacctgaccgatgagggcgaaatcggtcggggtgcgtttggagcggtcaatcagatg
aagttcaatcgaacggacaccgtgatggcagtgaagcggatccgttcgaccgtcgacgag
aaggagcaaaagcaactgctgatggatctggaggtggtgatgaaatcgaacgactgcaac
acgatcgtcacgttttacggtgccctgttcaaggagggcgactgttggatttgcatggag
ctgatggacacctcgttggacaagttctataaatttatctgtgattgccaacactcgcgg
atcccggaaccgatcctgggccagattacgctggccacggtgcgggcgctaaactacctg
aaggaggaactgaagatcatccacagagatgtgaaaccgagcaatatcctactgaagcgg
aacggtgatatcaaactgtgcgatttcggcatttcgggccagctggtggattcgattgcg
cggactaaggatgctggctgtcggccgtatatggcgcccgaacgaattgatccgcagcgc
gctaagggatatgacgtgcggagtgacgtttggtcacttggtatcacactgatggaggtg
gccaccgggaagttcccctatccgaagtggggatccgtatttgaacagctgtcgcaggtc
gtcgaaggagatcctccaaggttgtctcaatcatataataacatggagttttcgctagat
tttgtaaattttgtcaacacttgcctaataaaggacgaaaaggaccggcccaagtacggc
aaactgctgcagcatccgttcatccagcgtgccgacaagagccacaccgacgtgtccgtg
tacgtgagcgcgatactggagtcgatggccaacaacggcatcacccagttcactacgaac
ctgccggccgagcgttggagcgacagtttcaactag

DBGET integrated database retrieval system