KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003297Help
Entry
AaeL_AAEL003297   CDS       T01053                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aag00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 500 aa AA seqDB search
MKAVQLLVLSCLWLGYSQAIPLEPQPRSSVDYWTNDAQQTIESILRQRENRNIAKNVILF
LGDGMSVSTVAMARMYAEDEATKLSFERFPFIGMSKTYCVNKQVPDSACSATAYLTGVKG
NYETLGVNGKIPSYDCTAELDESTHTFSIAQWAMDAGKDAGLVTTTRVTHASPAAVYAHT
SNRDRENDNEVKKDGCDPNVTKDIAMQLVHGKTGQGLKVILGGGRREFMHKHPDPETGSN
GKRKDSRNLIEEWLNLASPGENRTYVWKRDDLMGVDPAKTDRLFGMFDPSHCVYNLERIQ
EGLDQEPTLAEMVDKATDMLRKSDKGFFLFVEGGRIDHAHHRNWARLSLDETVEFSKAVE
LARNKFSEEDTLILVTSDHSHAVTYSGYSARGKDILGAHNDANDDLPYKTVSYANGLGFY
DHVSPSDGGRVNVADLDALWREFRYPATLPLESETHGGEDVAVYASGPWAHLFKGTYEQN
AIPHMLAYASCVGDGLKACS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtccaattgctggttctgagctgcttatggctcggatactctcaagctatc
ccacttgaaccacaaccccgcagttcggtggactactggaccaacgatgcgcagcaaacc
atcgagagcatcctgcgccaacgggagaaccgaaacatcgccaaaaacgtgattctcttc
ctgggcgatggaatgtcagtttcgacggtggcgatggcccggatgtacgcagaagatgaa
gccacgaaactgtccttcgagcggtttcccttcattggtatgtccaaaacgtattgcgtg
aacaagcaggttccggattcggcctgctcggcgacagcttacctgactggagtgaaaggt
aactacgaaacgctcggagtcaacgggaagatccccagttatgactgtacggccgagcta
gacgagtcgacacacaccttttccatcgctcaatgggccatggatgccgggaaggacgcc
gggctggtaacgaccacgagagtgacccacgcatcgcctgcagctgtctacgcccatact
tccaatcgggatcgggaaaatgataacgaagtgaaaaaggatggttgtgatcctaacgtt
acaaaggacattgccatgcagttggtgcacgggaagaccggtcagggattgaaggtcatt
ctgggtggcggaaggcgtgagtttatgcacaaacatccggatccggagactggtagcaat
ggtaagaggaaggacagtaggaatttgattgaggagtggttgaatttggcttcgccgggt
gagaacaggacgtacgtgtggaaacgtgatgatttgatgggagtagacccggcgaaaact
gacaggttgttcggtatgttcgatcccagccattgcgtgtacaacttggaaagaattcag
gagggtttggatcaggaaccaactcttgcggaaatggttgacaaagcgacggatatgttg
cgcaagagtgataaggggttctttctgtttgtggaaggaggtcggatcgatcatgcccac
catcgaaactgggctcgtttgtcactggatgagaccgtggagttctccaaagcggttgaa
ctagcaaggaacaagttcagtgaggaggacactctgattctagtcacttctgaccattcg
catgctgttacctattctggttattcggcacgaggcaaggacattctgggtgcccataac
gatgcaaacgacgatcttccgtacaaaactgtgagctatgctaacggtttgggattctac
gatcacgtcagcccctccgacggaggcagggtcaatgttgcagatttggatgcattgtgg
cgggagttccgttatccagcaactcttccgctagagtcggaaacacatggcggagaagat
gtagctgtatacgcatccggtccttgggcgcacttgttcaagggaacctacgaacaaaac
gcgattccacacatgctagcctatgcatcgtgtgtgggtgatggactgaaggcctgctcg
tag

DBGET integrated database retrieval system