KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003313Help
Entry
AaeL_AAEL003313   CDS       T01053                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AaeL_AAEL003313
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AaeL_AAEL003313
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AaeL_AAEL003313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 556 aa AA seqDB search
MKAVITVVTTLLVAVAATNEVHRSYDNDHQHQRSSSINGRQAATIDPAEATSDFWRQKAQ
ETLKAKLQEAPVIAKAKNVIYFIGDGMSAQTIAATRMYLGNENKMLSFEQFPYLATAKTY
CVNRQVADSACTATAYLSGVKTNYGMINVGPHVPRYSCTYNRTESEFLGLLKWAQEADMA
TAVVTNARITHATPAGAYASITNRDWEDDSYVTNAGCDATKYPDVAHQLVHGEVGKRLNV
ILGGGRRHFVPSTQMDDENVAGSRADGRNLINEWKEAHPNNATYVWNKSGLQSIDVTNIE
NVLGLFDSSHSLYNLEIDDQRLGAVKPKLTDMVDAALKMLTKDKDKGYFLFVEGAKIDMA
HHDSRPRLALEETAEFSRAIELARNITALDDTLIVVSSDHGHTMTYNGYPKRGSDILGIG
GYSDEDGLPYTTLSYANGEGYYLTYKEGNPAERVDFSQYDLTDHQTLYMATVPLNAESHG
GEDVAVFASGPMAHIFRGNMEQNVLPDLISYAAKIGKYKENGGDGDGQPGSGSSLALCIQ
LMVVCGVTVLLGQLKW
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttatcacagttgtcacgacacttctggttgctgtcgcggcaaccaacgag
gtccatcgaagctacgacaatgatcatcaacatcaacgatcgagctcaatcaatggacgt
caagccgcaacaatcgatccagctgaggctacgtccgatttctggcgccagaaggctcaa
gaaacgctcaaagccaaactgcaggaagcaccagtgattgccaaggcaaagaacgtaatt
tacttcatcggtgacggaatgtccgcgcaaactattgcggccaccagaatgtacctcgga
aacgagaacaaaatgctttcgttcgaacagtttccatatctggctaccgcaaagacgtat
tgtgtaaatcgtcaggtggcggattcggcttgtacggccacagcgtacctctctggagtc
aagaccaactacggaatgatcaacgtaggcccgcatgttccgcgatacagctgcacatac
aatcgtacggaatccgaatttcttgggttgctcaaatgggcacaggaagctgacatggct
acggctgtagtgaccaacgccagaatcactcatgccactcccgccggagcgtacgctagc
attacgaaccgtgattgggaagatgactcttacgtaacgaacgcaggatgtgacgcaacc
aaatatccagacgttgctcaccaattggtccacggtgaggttggaaagaggctcaacgtt
attttgggcgggggtcgcaggcattttgtgccatcgacgcaaatggatgatgaaaacgta
gcaggttctcgcgctgatggacggaaccttatcaacgagtggaaagaggctcatcctaac
aatgcaacttatgtatggaacaagtccggtctgcagtcgattgatgtcaccaacatcgag
aatgttctgggactgttcgacagcagccacagtctgtacaatctagagattgacgatcaa
cggctgggtgccgtaaagccgaagctaacggatatggtggacgcggctcttaaaatgttg
accaaggacaaggacaaagggtacttcctgttcgtggaaggtgccaagatcgacatggca
catcatgactcgcgaccgcgtttggcactggaagagacggcggagttttcacgtgccatt
gagctggcaagaaatataacggcactggatgacactttgattgtggtgtcgtcggatcac
ggccacacgatgacctacaacggatatccgaaacgaggcagcgacatcctcggcatcgga
ggctacagcgatgaagacggacttccctacacgaccctgagctacgccaacggtgaaggt
tactacctaacgtacaaagaggggaatcccgccgaacgggtagatttcagccaatatgac
ttaacagaccaccagaccctgtatatggccacggttccactgaatgcggaatcacacggc
ggtgaggacgtggctgttttcgccagtggtcctatggcccatatcttccggggaaacatg
gaacagaacgtactgccggatctgatttcgtacgcggccaagattggcaagtacaaagaa
aatggcggcgatggggacgggcaaccgggatctgggtcatcactggcgctgtgcatccag
ctgatggttgtttgcggggtgacggttttgttaggccaactgaagtggtag

DBGET integrated database retrieval system