KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003359Help
Entry
AaeL_AAEL003359   CDS       T01053                                 

Definition
dual specificity mitogen-activated protein kinase kinase hemipterous MAPKK
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aag04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 977 aa AA seqDB search
LPLRTQSNSRRNEAELMKIIDKSGMIKINDQVFKTTLVEMQDLGELGSGTSGHVVKMRHS
PSGAVIAVKQMRRTGNDEENKRIIMDLDVVLKSENCRYIVKCLGCFITDADVWICMELMT
TCFDKLQKKSKKPVPERILGKVTVATVNALAYLKDNHNVIHRDVKPSNILIDDRGNIKLC
DFGISGRLVDSNARTRSAGCAAYMAPERIDPANQSYDIRADVWSLGITLVELATAMFPYR
NCKTDFEVLTKVLTSNPPSLPEDQDFSSHFRDFVKVCLRKNYEDRPKYPDLLKHPFLQRA
KQEEVDVAGWFRDVAFSSGIQLSTTPQLVASGSGVSSSSLVGSGSSPTSVSIQRPSSSAS
DQNRVPTPYESLTEAVQAQSNQQKQSAIASSIPIKSSNLQTQPQNNIDAQQQQTLQVKLS
SISLAPSQATSSSTASSIDIRSPSPAQPQQQQMQTPQANYLKLQQPNAIFSTSTNSSSSN
SHHTGPEVNRKYKHSPFLPRRVAATDPIANAAENPLHAYGSPKKESTLSSLGQSIFRNLT
TSPFSHRKSEQKSYKPPLPGEDGGGGGMAMLNGNRPGFSNPSSPLLLNRKMIDLNDEQQY
KQLQGNTSPIVLQRFYHQQNQLRESKQQQLEQQLSTNPFYQPQQPSGIPIKYSPLPSHRT
VHHAANPAFAGGSYMGYHPVLPHEASNIPTYQYQQLNNAGSNSSSSPSKPKTSGFFNTFS
RSKSQNNGSASSSQRGNAGTSGVGIPGSDGGFPEAGFYQNHQLYGRQTLPEYGSAGLGMP
SGISNGDNMMKDDTAGWFNSIADLAKRRFASFVKVNLASSTGEKRPKDKHLQNHMLQMQQ
HQPPQYPFTGGNGSLVAPMNNYPASTNPFVGPSSGIPSAIPPSAAAHVLGNDRRHRSPDP
PPRYNRGQSPLLLHRKLEKLGQTGSPLLNQRFTSASPSPPLPPRRGSESVPGSPQHIRTR
LHYTPEPHRRPYRTIDQ
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
cttccactgagaactcagtccaacagtcgacggaacgaagctgaactgatgaagattatc
gacaaaagcggaatgatcaaaatcaacgatcaggtgttcaaaactacgttggtcgagatg
caggatttgggagagctgggcagcggaactagcggccatgtggtcaaaatgcgccacagt
ccgagtggagcggtcattgccgtcaagcaaatgcgtcgcacgggaaacgatgaggagaat
aagcgaatcatcatggatctggacgtggtgctcaagtcggaaaactgtcgctacatcgtc
aagtgcttgggctgtttcataaccgatgcggacgtgtggatctgtatggaactgatgacg
acctgtttcgacaagctgcagaagaaatccaagaaacccgtcccggaacggatactgggc
aaggtgacggtggccacggtgaatgcgttggcttacctgaaagataaccacaacgtgatc
catcgggacgtgaaaccctcgaacatactgatcgacgaccggggaaacatcaagctgtgc
gatttcggcatcagtggtcggttggtggattcgaacgcccggacaaggtcggctgggtgc
gctgcgtatatggcgcccgagcgaatcgacccggctaatcagtcgtacgacatccgggcg
gacgtttggtccttgggtatcacgttggtcgagcttgccacggcaatgtttccctaccgc
aactgcaaaacggacttcgaagttctcaccaaggtgctcacgtccaacccgcccagcctg
cccgaggatcaggacttcagttcgcactttcgggactttgtcaaggtgtgcctgcggaag
aactacgaagatcgaccgaaatatccggacctgttgaagcacccgttcctgcagcgagcc
aaacaggaagaggtggacgttgccggctggttccgcgacgtggccttcagcagtggcatc
cagctgagcaccaccccgcagctggttgcgtccggcagtggggtttcttcctcgagttta
gttggctccggcagctcgccgacttccgtcagtatccagaggccttcttcgtcggcgtcc
gatcagaatagagtcccgaccccctacgaaagcctgacggaagcggtccaggcacagtcc
aaccaacaaaagcaatcagcaatagcttcgtcaataccgataaagtccagcaatctacaa
acgcaaccgcaaaacaatatcgatgcccagcagcagcaaacgttacaggtgaaacttagc
agcattagtttagcgccgtcacaagctacctcgtcttccactgcatcatctatcgatata
cgatctccctcgcccgcacaaccacagcaacagcaaatgcaaacacctcaggcaaattat
cttaaattgcaacagccaaatgcgatatttagcactagtaccaatagcagcagcagcaac
agccaccacactggtccggaagtgaaccgaaagtacaaacattcgccatttctaccgcgg
agagtagcagcgacagatccaatcgccaacgcagccgaaaatccacttcacgcttacggc
agcccaaaaaaagaatcgacactcagcagcctgggtcaaagtatattccgtaacctgaca
acgtctccgttttcgcaccgcaaatccgaacagaagtcgtacaaaccaccgcttccgggc
gaggatggtggcggtggtggaatggcgatgctaaatgggaacaggcccggtttcagcaat
ccatcgtcaccgcttctccttaaccggaagatgatcgacctgaacgacgaacagcagtac
aagcaactgcagggaaacactagtcctatagttcttcaacggttctaccaccagcagaac
cagctgagagaaagtaaacagcagcaattggagcagcaactgtcgacaaacccgttctat
cagccgcaacagccgagtggaatcccaattaaatacagtcccctgccatcgcatcggacg
gtacatcacgcggcgaatccagcttttgccggtggaagctatatgggctatcatccggtc
ttgccacatgaggcgagcaatataccaacctaccagtaccaacagctcaataatgccggc
agtaacagcagcagtagtcctagtaagccaaaaacgagcggcttcttcaacacctttagt
cgatctaagagtcaaaacaatggaagtgccagttctagtcaacggggtaatgcgggtact
agtggagttgggatccctggtagcgatggtggcttcccggaagcaggtttctaccagaac
catcagttgtatgggcgacaaacgttaccggagtatggcagtgcgggattgggcatgccc
agcggtatcagcaatggcgacaacatgatgaaggacgatacagcagggtggttcaattca
attgcagatcttgccaaacgacgattcgcttctttcgtgaaggtgaacctagcctcgtca
acgggcgagaaacgaccaaaggacaagcatctacagaaccatatgctacagatgcaacaa
caccagccgccgcagtatcccttcaccggtggaaacggttccctggtggctccgatgaac
aactatccggccagtacgaaccctttcgtagggccgtccagtggtattccgtcggcgata
ccgccatcagctgcggctcacgtgttgggaaatgatcgacggcatcggagtcccgatcca
cctccaaggtataacagaggacagtcgccattgttgttgcatcgaaagctagaaaaatta
ggacaaacggggtcgccactgctcaatcaacgcttcacctcggcgtctccgtcgcctccg
ctgccaccccgacgcggctccgaaagcgttcccggttctcctcagcacatccgcacccgc
ctgcactacactccggaaccgcacaggcgaccctaccggacgatagaccaatga

DBGET integrated database retrieval system