KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003370Help
Entry
AaeL_AAEL003370   CDS       T01053                                 

Definition
Dual specificity tyrosine-phosphorylation-regulated kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 508 aa AA seqDB search
MLSTQTLTNGLAAQYASGNVPDSTRQRHHAPLYGRLVTEEHLPAAHRDIHQRSISPTSST
DIRAMQARIPSHFRDPTTAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQTQGEDTSHKKE
RKLYNDGYDDENHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEECQVAIKIIKN
KRPFLSQAQIEVNLLEMMNRADAENKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNT
NFRGVSLNLTRKFAQQLCTALLFLSSQELNIIHCDLKPENILLCNPKRSAIKIVDFGSSC
QLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEADQINK
IVEVLGMPPKHILDQAHKTRKFFEKLPDGTYVLRKTQNQRKYKAPGTRKLHDILGVETGG
PGGRRHGEPGHSVSDYLKFKDLILRMLDYDPKTRCTPYYALQHNFFKRTSDESTNTANTI
SSLSTSPSVSTQDPSSHGESRINNRRCF
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctttcaactcaaacacttaccaacggtttagcagcacaatatgcatccggaaatgtt
cctgactcaacgcggcaaaggcatcatgcgccgctttacggaagactggtcacagaagaa
cacttacctgccgctcatcgtgatatacatcagcgttcgataagtcctacatcatcgaca
gacattcgggcgatgcaagcccgaataccatcgcattttcgagacccaacgacggcaccg
ctgcggaagctgagcgtggatctaatcaaaacctacaaacacatcaatgaggtttactat
gccaaaaagaaacgaagagctcaacagacccagggcgaggacacgtcccacaagaaggag
cgaaagctatacaacgatggctatgacgacgagaaccatgactacatcatcaaaaatggc
gagaagtttctcgatcgctatgaaatcgattcacttatcggcaagggcagcttcggccag
gtggtgaaagcctacgaccacgaggaagagtgccaggtggcgataaaaatcatcaaaaac
aaaagacccttcctcagtcaagcacaaatcgaggtgaacctgctggagatgatgaaccgg
gcggacgcggagaacaaatactatattgtaaggctgaagcgacactttatgtggcggaat
cacctgtgtttagtattcgagctgttatcctataatttatacgacttattgcgcaatacg
aacttccgcggggtttcactgaatctaacgaggaagtttgcccagcagttatgtacggcg
ttattatttttaagttcacaagaattaaatatcatacactgtgatttaaaaccagaaaat
atattattatgtaaccctaaacggtcagcaattaagatagtagattttggcagttcatgt
caactaggacaaaggatatatcaatacatacaatcacgtttctaccgctcgccggaggta
ctattagggataccgtacgacttagcaatagacatgtggtcgctcgggtgcatactggtg
gaaatgcacaccggtgagccgctgttttccggctcgaacgaggcggaccaaatcaacaag
atcgtcgaggtgctcgggatgcccccgaagcacatcctcgaccaggcgcacaaaactcgc
aagttcttcgagaagctcccggacgggacgtacgtgctgcggaaaacgcaaaaccagcgc
aagtacaaggcaccgggcacgcggaaactgcacgacatcctcggcgtggaaacgggcgga
ccgggcggccggaggcacggcgaacccggccacagcgtatccgactatcttaagtttaag
gacctaatcttaaggatgctggattacgatccgaagacgcgctgcacaccgtactatgcc
ttgcaacacaacttcttcaagcggacgtcggacgagagcaccaacacggcgaacacgatc
agctcgctcagcaccagcccgtcggtgagcacgcaggaccccagcagtcacggtgagtcg
cgaatcaataatcgtcgttgtttctaa

DBGET integrated database retrieval system