KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003517Help
Entry
AaeL_AAEL003517   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 533 aa AA seqDB search
SPGREMSDHGCAHFAAFVKEYGLESFSVVHAYFSACINKEARRRKALSCLCYKCGGSGPQ
LYSCLHCIYFGCKGAHINDHCKQTKHYIVLELCYGMIYCYQCKDFTYDSECQAIAEKHIR
KEAKSLNKSLSWRPWSPSKLEIDLLLKNPKRRHVTAFTSIGLRGLLNLGSTCFMNCIVQA
LIHTPLLRDYFLSERHECTTKTAAKCLVCEVSRLFQEFYSGARGPLSLHRLLHLIWNHAR
HLAGYEQQDAHEFFIATLDVLHRHSSADKSKQQQFQQPDNPTHCNCIIDQIFTGGLQSDV
VCQACNGVSTTIDPFWDISLDLGEAQNQGYGGPPKSLIDCLERFTRAEHLGSSAKIKCSS
CKSYQESTKQLSMRTLPIVASFHLKRFEHSSLIDKKISTFISFPSELDMTPFMSKKKSEQ
QSPGTSSGSASSSKSKSSDRKHAAGSSGTSGTGGSEDDHNRSHHDTSDFRYSLYAVINHV
GTLDAGHYTAYVRHQKDIWVKCDDHIITTATLKQVLDSEGYLLFYHKKILEYE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
agcccgggccgtgaaatgtccgatcacggttgtgctcactttgcggcgtttgtcaaggag
tacggactggaatcgttcagcgtggtgcacgcgtatttcagtgcctgcatcaacaaggaa
gcccggcgtcggaaggctctgtcctgcttgtgttacaaatgtggtggttccggtccgcag
ttgtattcgtgcctgcactgtatctatttcggatgcaagggggctcacattaacgaccac
tgtaagcagaccaagcattacatcgtgctggaactgtgctacgggatgatctactgctat
cagtgcaaggacttcacgtatgatagcgaatgccaagcaatagccgagaagcacatccgg
aaggaggccaaaagtctgaacaaaagcctatcctggagaccgtggtcaccttccaagctg
gagattgatttgctgctgaagaatcccaagcgtagacatgtgaccgcttttaccagtatt
ggactgcgaggattgctgaatctgggatcgacctgcttcatgaactgtattgtccaagct
ctgattcatacgcctctactcagagactacttcctttccgagaggcacgaatgtacaacg
aagactgctgccaaatgtctcgtttgtgaggtgtccagactgttccaggagttctactcc
ggcgcaagaggtcctttgtccttgcatagattgttgcatttaatatggaaccatgcgcgt
catctcgccggatatgagcagcaggatgctcacgagttcttcattgccacactggacgtc
ctgcatcgccactcttcggcggacaaatccaaacagcaacagttccaacagccggacaat
ccaacccactgcaactgcatcatcgatcagatctttaccggtggccttcagagcgacgtg
gtttgtcaggcttgcaacggagtctccacgaccatcgatcccttctgggacatttcgctc
gacttgggcgaagcgcagaaccagggctacggtggcccgccgaaatcgctcatagactgc
ttggaacggttcacccgggccgaacatctgggttccagtgcgaagatcaaatgttccagc
tgcaaaagctaccaggaatcaacgaaacaactgtccatgcgaacactgccaatcgtcgcc
agcttccacctgaagcggttcgaacattctagtctgatcgacaaaaagatctcgaccttt
atctcattcccgtcggagttggacatgactccgttcatgtcgaaaaagaagtctgaacag
cagtcgcccggaacgtcgtccggttccgcgtcttcgtcgaaatcaaagtcttcggatcgg
aagcacgccgctggaagtagcggcacaagtggcaccggtggcagtgaagatgaccacaac
cgatcgcaccacgataccagtgacttccgctactcgttgtacgcggtgataaaccacgtg
ggaacgttggacgccggccactacacggcctacgttcggcaccagaaggacatatgggta
aaatgtgacgaccacattataacgactgccacactcaagcaggtgctagatagcgaaggc
taccttttgttttaccataagaagatcctagagtacgagtaa

DBGET integrated database retrieval system