KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003606Help
Entry
AaeL_AAEL003606   CDS       T01053                                 

Definition
purine biosynthesis protein 6, pur6
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AaeL_AAEL003606
Enzymes [BR:aag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     AaeL_AAEL003606
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     AaeL_AAEL003606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 427 aa AA seqDB search
MAAVTEVGGIKLGKLLIEGKTKQVYDVPSLPGHSILLNKDRITAHNGVRAHDLEGKAQIS
NQTNAKVFGLLNQVGLKTAFVRMVSDNAFLARKCEMVPIEWVTRRLATGSYLKRNPGVKE
GFRFSPPKQETFYKDDANDDPQWSEEQIVSAGFKVNGVLIGQDEVDIMRQTTILVFEVLE
RAWATRNCALIDMKIEFGVDADGQLLVADVIDSDSWRLWPSGDKRLMVDKQVYRNLASVT
ASDLDTVKRNFLWVSEQLDNLQPKNDHLVVVLMGSPSDKDHCEKIAKHCRELGLNVELRV
TSAHKGTKTTLHIVNEYESVLSNLVFITVAGRSNGLGPVLSGNTNYPVINCPPVKPENVS
LDVWSSLNLPSGLGCATVLYPEAAALNAAQILGLNNFLIWSKLRVKQLANFTSLIYADKG
FRGVRKE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggtcacggaagtcggtggaatcaagctgggtaagctgttgatcgagggtaag
accaagcaggtatacgacgtgccttcgctgccgggtcactcgatcttgctgaacaaggat
cgtattacggcgcacaatggcgttcgggcgcatgacctcgaaggaaaggcccagatctcc
aaccagaccaacgccaaggtgttcgggctgttgaaccaggtcggcctgaagacggctttc
gttcggatggtttcggacaatgctttcttggcgcgcaagtgcgagatggtgccgattgaa
tgggtcaccagaagactggccaccggatcgtatctgaaaagaaaccccggcgtaaaggaa
ggattccgattctcgccaccgaagcaggaaactttctacaaggacgatgccaacgatgac
ccgcagtggagcgaagagcagattgtctccgccggtttcaaggtcaatggagtgttgatc
ggtcaagacgaggtggacatcatgcgccagacaaccattctggtgttcgaagtcctcgaa
cgtgcctgggccacccgtaactgcgccctgatcgacatgaagatcgagtttggagtggac
gccgacggccaactgctggtggcggacgtcatcgattccgactcgtggcgtctgtggcca
tcgggcgacaagcgcctgatggttgacaaacaggtctaccgcaacctggcttcggttacc
gcctccgatctggacaccgtcaagcgtaacttcctgtgggtcagcgagcagttggataac
ctgcagccgaagaacgaccatctcgtggtggtgctgatgggcagcccctcggacaaggat
cactgcgagaagatcgccaagcattgccgcgagctgggattgaacgtggagttgcgggtg
acctcggcgcacaagggaaccaagacgacactgcacatcgtgaacgagtacgagagcgtc
ctgagcaacctggtgttcatcacggtggccggtcgctccaacggccttggaccggtcctg
tccggtaacaccaactatccggtgatcaactgcccaccggtgaagcccgagaacgtcagc
ttggatgtgtggtccagcttgaacctgccgtcgggactgggatgtgccacggtactgtac
ccggaagcggcagccttgaacgcggcgcagattctcgggctgaacaacttcctgatctgg
tccaagctgcgcgtcaagcagctggccaacttcaccagtctgatctacgccgacaagggc
ttccgcggggtcaggaaggagtag

DBGET integrated database retrieval system