KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003606Help
Entry
AaeL_AAEL003606   CDS       T01053                                 

Definition
purine biosynthesis protein 6, pur6
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aag00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 427 aa AA seqDB search
MAAVTEVGGIKLGKLLIEGKTKQVYDVPSLPGHSILLNKDRITAHNGVRAHDLEGKAQIS
NQTNAKVFGLLNQVGLKTAFVRMVSDNAFLARKCEMVPIEWVTRRLATGSYLKRNPGVKE
GFRFSPPKQETFYKDDANDDPQWSEEQIVSAGFKVNGVLIGQDEVDIMRQTTILVFEVLE
RAWATRNCALIDMKIEFGVDADGQLLVADVIDSDSWRLWPSGDKRLMVDKQVYRNLASVT
ASDLDTVKRNFLWVSEQLDNLQPKNDHLVVVLMGSPSDKDHCEKIAKHCRELGLNVELRV
TSAHKGTKTTLHIVNEYESVLSNLVFITVAGRSNGLGPVLSGNTNYPVINCPPVKPENVS
LDVWSSLNLPSGLGCATVLYPEAAALNAAQILGLNNFLIWSKLRVKQLANFTSLIYADKG
FRGVRKE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggtcacggaagtcggtggaatcaagctgggtaagctgttgatcgagggtaag
accaagcaggtatacgacgtgccttcgctgccgggtcactcgatcttgctgaacaaggat
cgtattacggcgcacaatggcgttcgggcgcatgacctcgaaggaaaggcccagatctcc
aaccagaccaacgccaaggtgttcgggctgttgaaccaggtcggcctgaagacggctttc
gttcggatggtttcggacaatgctttcttggcgcgcaagtgcgagatggtgccgattgaa
tgggtcaccagaagactggccaccggatcgtatctgaaaagaaaccccggcgtaaaggaa
ggattccgattctcgccaccgaagcaggaaactttctacaaggacgatgccaacgatgac
ccgcagtggagcgaagagcagattgtctccgccggtttcaaggtcaatggagtgttgatc
ggtcaagacgaggtggacatcatgcgccagacaaccattctggtgttcgaagtcctcgaa
cgtgcctgggccacccgtaactgcgccctgatcgacatgaagatcgagtttggagtggac
gccgacggccaactgctggtggcggacgtcatcgattccgactcgtggcgtctgtggcca
tcgggcgacaagcgcctgatggttgacaaacaggtctaccgcaacctggcttcggttacc
gcctccgatctggacaccgtcaagcgtaacttcctgtgggtcagcgagcagttggataac
ctgcagccgaagaacgaccatctcgtggtggtgctgatgggcagcccctcggacaaggat
cactgcgagaagatcgccaagcattgccgcgagctgggattgaacgtggagttgcgggtg
acctcggcgcacaagggaaccaagacgacactgcacatcgtgaacgagtacgagagcgtc
ctgagcaacctggtgttcatcacggtggccggtcgctccaacggccttggaccggtcctg
tccggtaacaccaactatccggtgatcaactgcccaccggtgaagcccgagaacgtcagc
ttggatgtgtggtccagcttgaacctgccgtcgggactgggatgtgccacggtactgtac
ccggaagcggcagccttgaacgcggcgcagattctcgggctgaacaacttcctgatctgg
tccaagctgcgcgtcaagcagctggccaacttcaccagtctgatctacgccgacaagggc
ttccgcggggtcaggaaggagtag

DBGET integrated database retrieval system