KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003611Help
Entry
AaeL_AAEL003611   CDS       T01053                                 

Definition
stearoyl-coa desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AaeL_AAEL003611
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AaeL_AAEL003611
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AaeL_AAEL003611
Lipid biosynthesis proteins [BR:aag01004]
 Desaturase
  First
   AaeL_AAEL003611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 363 aa AA seqDB search
MSTCETATSSTENSEKFSNSNSSSSADVPKDATPSEGSRTESSSRDNKREASWPSVLFYI
HLNILGVYGIFVLFSHTSAITFLFTSFLTLCGILGATAGAHRLWAHKTYQASTLLRFSLM
LCQTLAGQGSIYDWVRMHRLHHEKFRTPDDPYYSDKDFLHAQVFANIRKLSPRQEKLLEQ
IDMRDLESDKIVMFQKRFYWLLYPILFVLLPINAPLEYWGDTVQAAIFVAFSLRYLLVLN
VAWLINSAHFIWGLDKNHKQSDSNMVFVVTKSYWPQYHYLLPFDYQSGEFGNYGSGCTTA
FIRVFAAMGMATKLQTMTTEAVKKGLTMAVDSGRPIVDCLKQAGAEDMCNLQREHYLKNE
RLH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctgcgagacggcgaccagttcaactgagaacagcgaaaagttctccaattca
aactccagttcctcagcggatgtgcccaaagatgctacccccagtgaaggctctcggact
gagagcagttctcgagacaacaaaagagaggccagttggccctctgtgttgttctacatt
catctcaacattctaggagtctatggaatattcgtactattctctcacacctcagcaatc
actttcctattcacatcttttttaacattatgtggaatattgggagccactgccggggca
catagattatgggctcacaaaacctaccaggcttcaacgttacttcggttttcgttaatg
ctgtgtcaaacgctagcagggcagggctctatctatgactgggtacgaatgcatcgatta
catcacgagaagttccgtaccccggacgatccatactacagcgataaggatttcctccat
gctcaagtatttgccaacatccggaagctcagcccccgacaggagaaactgctcgaacag
atcgacatgcgcgatcttgagtccgataaaattgtaatgttccagaagcggttctactgg
ctgttgtaccccatcctgttcgttttactgccaatcaatgcccctctggaatactggggt
gataccgtacaggctgcaattttcgttgccttttccttgcgatacctgctggtgttgaat
gtagcttggttgatcaactcagctcacttcatctggggactggacaagaaccacaaacaa
agtgactccaacatggtgttcgttgtgaccaagagttattggccacagtaccattacttg
ctaccgttcgactatcaaagtggagaattcggtaattacggatcaggatgcaccactgcc
ttcattcgagtatttgctgccatgggtatggcaacgaaactacaaaccatgactacggaa
gctgtgaagaagggattgacgatggccgtagacagcggacgaccaattgtggactgtttg
aaacaggctggcgcagaagatatgtgcaacttgcagcgggaacactatctcaaaaacgag
agacttcactaa

DBGET integrated database retrieval system