KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003723Help
Entry
AaeL_AAEL003723   CDS       T01053                                 

Definition
lysozyme P, putative
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     AaeL_AAEL003723
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AaeL_AAEL003723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 148 aa AA seqDB search
MRNLNLLIVLVGLFALLSVNVEAKKFDKCSLAKALLAQGFNKADLRNWVCLVQNESGMDT
NKKNNNRNGSTDWGLFQINDRYWCDPQDKKKKTSNECKIKCSELLKDDISKASACVKKIY
KRHGYRAWYGWLNRCEGKALPDLSKCKL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacttgaatttattgattgtactggtgggtctttttgccctgttgagtgtaaac
gttgaggccaaaaagttcgacaagtgttcgctggccaaagctctactcgcgcaaggattc
aacaaagccgatctccgaaactgggtatgcctggtgcagaatgaaagcggtatggatacc
aacaagaagaacaacaatcgcaatgggtccaccgattggggcctgttccagatcaacgat
cgatactggtgcgatccacaggacaagaagaaaaagacttcgaacgagtgcaagattaag
tgttctgaacttctaaaagacgacatcagtaaggcttcagcgtgtgtgaaaaagatctac
aagcgacacggctacagagcctggtatggatggctcaatcgctgtgaaggcaaagcgctt
cccgatttgagcaaatgtaaactgtaa

DBGET integrated database retrieval system