KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003733Help
Entry
AaeL_AAEL003733   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AaeL_AAEL003733
Peptidases [BR:aag01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AaeL_AAEL003733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 1584 aa AA seqDB search
MIVQINALASTLYTPASAGAGGAGGYKGTVGRKQHRTKRRQSNASSVMSSSDGSGVYEFV
PYESRRYPSSQHHHHHPQTVATFPNPVAPEYHYQPRHHSTYSQQFPYSSSNASSVDGSGG
FGRHPAASKRTANIRTQDHQANPGRNSHHYNYHHYQQQQQHQQQHSWSPVAVAASTIAAT
TGIIATTTTSTSSYTLPNSSVNTNLEATYTEYGESEQRLSCSAHSSSTNSSSSYRVVSGR
NYSSRTGERVAASTPDGTTTAISEASTTTTMPPHTNNPHYPSQQQQQTQQGQPPQTQQGN
PPPNSHNVAVNVSRGSSDQQSVVASAPQQMYPSQHYMTGGPPGNAMYPMPVIPQPIPGNV
YVSNLTANVNVHGFVPHGMPQYVTTGASPAPTGAYITGEVPSGHEMQIMTPRGEARGGMR
RNGRSGRIGHNTRPRGGFVPHYIAQQQTVMQSSQPAGIHHQQQPGQVQGQLPQQGVQQSQ
QQQSQSQSQNQSQSQPSQPPQQHTPDMVQHSMSMEHQPIMSPAQPVTYGGYGGYYFYPPF
YPSVTPGHHPSAQHAAGAPILQVPMYQTMYSYSPSVVYQPMYSSEYPLYDGKGEDHNPQQ
PPEDGVMHQDMWQQPTMIEYNPENVEYIPPEEDMNMMQQGPPTMQPITHLHIGSTTRTYS
GTYTNTNAHNYCARDNSTNTSSSSSNSNITYTNSSTITDYYNPCPSTPAQRTTSADTAVD
KTSEMSTNSSKPVPNQQSQQHHQSQFFVNSNKSQTSTEEVARLQRTVQEKLVFKDDRRNG
PYWTNPGSQPPATTISSFTSSTTTIVQHNSSQQQKKTTASVSVSAIPNKEYTSSSSTSSG
PSVISSTKPYQKNTSPVPFTTLGTTSAPPSIHKQPLAPQKSYSSSEHHTATPVNSGPVME
SKKVEAIPQRDSQINTPLPPPGLPPSLSVPPPQRQYTQGQMIVQTPYVPPPPATTAAAPQ
TKSWASLFNPSSSSATSTPGPTSSIVQPIATSAPVAPSLLAAGPALPTPSPFAPSFVPTQ
HRSSHSSSASNQSADKTTAASSSTSNKPIAKVSPFDKSNNNSNSGTTAMSYSAASAQGLP
SASAGHTTSASASAASTASAGSKNKNNAAAQAQAAAAAAKPEQIDENTLKLGEFLSAYQI
ENNSISILPRGLINRSNYCYINAILQALVACPPFYHLMRAIRSLPAARNSKHQKPFIDAM
SALVDEFSTLQLRSKVQRDKTKKDETPEIQCDSPMEPLMIHRMLNLLRSDIFQVEGRQED
AEEFLGCVLNRLNDEMIELMKLSKNESDVNGDDAANGEVHPDDQDDWKVIRGNRNKGTVT
RTTDFGRSPMSDIFGGKLRSRVHREGDHATDNIQPFFTLQLDIEKATSVKDALDLLVGKD
QLEGVTCSKTKQEIAAWQQVTLEELPIVMILHLKCFDYKMDGCTKILKALEFPIELKIDS
KLMSSKGKSYTAKQKQYKLFAVVYHDGKEASKGHYITDVFHAGYGSWIRYDDSTVKPVSE
NNVLHPKSPRVPYLLYYRRLDTHYHGSAGGAGATTSGSTGTGGSGYGSGSSSSNTTSSSN
NSSTGGNSNYSSSVNAGGHYGGSK
NT seq 4755 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttcaaatcaacgcgctggcttcaactctgtacacaccggcttcggctggtgcc
ggtggagctggaggctataagggtactgttggccgcaagcagcaccgcaccaaacgaaga
cagtcgaacgcttcttctgtgatgtcgtcatccgatggatccggcgtgtacgaatttgtc
ccatacgagtcccggagatatccttcctcccagcatcaccatcatcatccccaaacggtg
gccacattcccaaatccggtggcacctgaataccattatcaaccccgtcatcactccaca
tattcccaacagttcccgtatagttcctcaaatgcctctagcgtcgatggttccggaggt
ttcggtcgtcatccggcggcatcgaaacgaacggctaacatccgcactcaagaccatcaa
gccaatccgggtagaaactcacaccactacaattaccatcactaccaacaacaacagcag
catcagcagcagcattcttggtcaccggtagctgtcgcagctagcactattgctgctacc
actggtattattgccaccactaccactagtacttcctcctacacactgccaaacagttct
gtgaacacaaatctggaagcaacatacaccgagtacggagaaagcgagcaacgactgagt
tgctcggctcacagcagcagtaccaacagtagcagtagttatcgtgtagtcagcgggaga
aattactccagccgaacaggcgaaagagtagctgcttcgacgccggacggcacgacaaca
gcgatctccgaggcgtctacgacgacgactatgccgccacacacaaacaatccccactat
ccgtcgcaacaacaacagcagacacagcaaggtcaaccacctcaaacacagcaagggaac
cctccaccaaatagtcataatgtagcggtgaacgttagtcggggctcgagcgatcaacag
agtgttgttgcttccgctcctcaacagatgtatccatcacagcattacatgaccgggggt
cctcccggcaatgcgatgtatccgatgccagtcattccccagccaattcctggaaatgtt
tacgttagcaaccttacagctaacgtgaacgtacatggctttgtgccgcatggtatgccc
caatatgtgacaacaggtgcatctccagcgcctacgggagcttacattactggtgaagtt
ccttctggacatgaaatgcaaataatgactcctcggggagaagcccgtggtggaatgcga
cgcaatggtagaagtggtagaattggacacaataccagaccacgaggaggatttgttcca
cattacatcgcacaacagcaaactgtgatgcaatctagccaaccagctggtattcatcat
cagcaacaaccaggacaagttcaaggtcagttacctcaacaaggagtgcagcaatcgcaa
cagcaacaatcacaaagtcaaagtcaaaatcaatcccaaagccaaccatcacaaccacct
caacagcacactccggacatggtgcaacattcgatgtccatggagcatcaaccaatcatg
agtccagcgcaaccagttacttatggaggttatggaggttactatttttatcctccattc
tacccctcggtaacaccaggacatcatccttcggcgcaacatgcagcaggagcgccaata
ctccaagtccctatgtatcagaccatgtacagctattcgccgagtgttgtgtaccaacca
atgtattcatccgagtatcctctatacgatggtaaaggggaggatcataatccacaacaa
ccaccagaagatggtgttatgcatcaggatatgtggcaacaaccgaccatgatagaatac
aatccggagaacgtagaatatatcccaccagaggaggatatgaacatgatgcaacagggg
cctcctaccatgcagccaataactcatcttcacatcggatcaaccacaaggacatattca
ggaacctacaccaacaccaatgcacacaactattgtgcaagagacaattcaacaaacacc
agcagcagcagtagcaacagtaatatcacctacacaaattccagtaccattaccgattac
tataacccatgtccctccaccccagctcaacgtaccacctccgccgataccgccgttgac
aagaccagtgaaatgtccacgaatagcagtaaaccagtgccaaatcagcaatcacagcag
catcatcaatcgcaattttttgtaaatagtaacaaaagtcagacttcaactgaggaagtc
gcacgattacaaaggacagttcaagaaaagctcgtcttcaaagatgaccgccgtaacggt
ccgtattggactaatccaggatctcaacccccggctacaacaatctcatcgtttacgtcc
tccacaaccaccattgtgcagcataacagtagtcagcagcagaaaaagacaacagcatcg
gtatcggtatcagccattccaaataaggaatacaccagcagtagtagcacctcatcgggt
ccatctgtcattagttccactaagccttatcagaaaaatacctcgcccgttccgttcact
actcttggaacaacgtctgctcctccgtcgatacataaacaaccgttagcaccacagaag
tcctacagttcctccgagcatcacacggcgaccccggtcaactcaggtccggttatggag
tccaaaaaagtggaagcaattcctcaacgtgacagccagataaatacccctcttccaccg
ccaggtcttccgccatctctttcggtgccaccgccacaacgtcagtatactcagggacaa
atgatcgtccagacgccctacgtaccaccaccaccggcaacgacggcggctgcacctcag
accaagtcctgggccagtttgttcaacccatcctcttcgtctgctacgtctactccagga
ccaacaagcagcattgttcaaccgattgctacttcagcccctgttgcaccgtctctattg
gctgcaggtccagccctcccaacgccatctcccttcgcgccaagtttcgtccctactcaa
catcgtagtagtcattcatcttcggcatcgaatcagtctgcggacaaaactacagcagct
tcttcatcaacatcgaacaaaccgatcgccaaggtgtcgcctttcgataagtccaataac
aacagcaacagcggtactacggccatgtcctactcggctgcctcggcccaaggtcttcca
tccgcttctgctggtcatacgacctccgcaagtgcctcggcagccagtaccgccagtgct
ggctccaaaaacaagaacaacgctgccgcccaggcgcaggccgccgccgccgctgccaaa
cccgaacagatagatgagaacactctcaagttaggagaattcctaagcgcgtaccaaatc
gaaaacaacagcattagcatccttcccagaggactgatcaatcgttccaactactgctac
atcaatgccatcctacaggctctagtggcatgtccaccgttctatcacctaatgcgggcg
atccggtcgctacccgcagccagaaacagtaaacaccagaaaccgttcattgacgctatg
tccgctctggtagatgagttttccactctgcagttacgctccaaggtacagcgtgacaag
acgaagaaagacgagactccggaaatccagtgcgattccccaatggaaccgctgatgatc
cacaggatgctaaatcttctgcgatcggatattttccaagtcgaaggccgtcaagaggac
gccgaggagttccttggctgtgtactgaatcggttgaacgatgagatgatagagttgatg
aaactgagcaaaaacgaatccgatgtcaatggggatgacgcggccaacggagaggtccac
cccgacgaccaggatgattggaaggtcattcgcggcaaccggaacaagggtaccgtcacc
cgcacgactgactttggccgatcaccgatgagtgacattttcggcggtaaattgcgatca
cgtgtccaccgcgaaggcgaccacgcaaccgacaatattcagcctttcttcacgctgcag
cttgacatcgagaaagccacctcagtgaaggatgctctggacctactagttggcaaggac
caactagaaggcgtgacctgttcaaagaccaagcaggaaattgctgcctggcagcaggtt
accctggaagagctacctatcgtgatgatcctacatctgaagtgttttgactacaaaatg
gatggatgcaccaaaatcctaaaggcgctggagttcccgatcgaattgaaaatcgattca
aaactgatgtcctcgaagggcaaatcgtacactgccaaacagaagcagtataagttgttc
gcggtggtatatcacgatggaaaggaagcatccaagggtcattatatcaccgacgttttc
cacgctggctacggtagctggattagatacgacgatagtacggttaagcccgtatccgaa
aacaatgtgctgcacccaaaatccccaagggtaccttatttgttgtactatagacgactt
gatacgcattaccatggttcggccggaggcgccggagctacaacgagtggcagtactgga
actggaggatccggttatggtagcggaagcagtagcagcaacacaaccagtagtagtaac
aatagcagcaccggtggcaatagcaattatagttctagtgtaaatgctggcggacactac
ggtggctccaaataa

DBGET integrated database retrieval system