KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003762Help
Entry
AaeL_AAEL003762   CDS       T01053                                 

Definition
Protoporphyrinogen IX oxidase, putative
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AaeL_AAEL003762
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AaeL_AAEL003762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 475 aa AA seqDB search
MTAILGAGISGLSAGYYLLKKGLPSPTVIYEASNRIGGWIRTDRFNEDGFVFEAGPRTIR
PKGPAASNTLDLIEEVGLADEVYPIYSNHVAARNRMIYAKGKLNMLPSDLSGVLKTVPPF
TKPLFFAGFKDIFAGRSKVPLEDESMYSFVERRFGKEIADYAVSSMLCGICAGDAKQISV
KFLMKSLFEMEQKHGGVVKGMLKEAMNKKGKKDGAKESISALAKRAKSENWSIYSIHGGL
QTLPDRLGTVLHKNGVGIETDVKFEEIMFDGGKVQLKVDGQDRVVDHLISSIPSYKLAKR
VSSQHPELSKELAAIPYVDVAVINLCYKTPDLQKHKGFGFLVPPIENLPILGVIFDSCCF
DMDDNTVLTVMMGGAWFEKWFGSNPDEELLLDVALKNVNRILDIQQAPDAYKVNLLRKCI
PQYVVGHHKRVEAIRAYIRDHKLPLGLCGASYDGVGVNDVILSARKCVEEQVKSK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgactgccatcttgggtgctggcatcagcggtctttccgctggatactatttgctcaaa
aaaggcctccccagcccaaccgtaatctatgaggccagtaatcgcatcggcggctggatc
cgtactgatcgattcaacgaggatggtttcgtgttcgaagcagggccacgcaccatacgc
cccaaaggtccggccgccagcaatacgcttgacctgatcgaggaagtgggacttgccgac
gaagtataccccatatattctaatcacgttgccgccagaaataggatgatctacgcaaag
ggcaagctcaacatgctgccgtcggacttgtccggtgtcctgaaaacggttccgcctttt
acgaaaccgttgttcttcgcggggttcaaagatatatttgcgggccgatccaaggttccc
ctggaggacgaatcgatgtacagctttgtggagcgaaggttcggcaaggaaatcgccgac
tatgcggttagctcgatgctgtgcggaatctgtgccggagatgcgaaacagatcagtgtg
aaatttctgatgaagagtttgttcgaaatggaacagaagcacggtggtgtcgtcaaggga
atgctgaaggaagctatgaataaaaaggggaagaaggatggagcgaaggaatcgatttct
gcgttggcgaagagggccaagtcggagaactggagtatttattcgatacacggaggcttg
cagacacttccggacaggttggggacagttctgcacaagaatggggtcggaatcgaaacc
gacgtgaagtttgaggagatcatgtttgacgggggtaaagttcaattgaaggttgacgga
caagatcgagtcgtagaccatctgataagtagtattccgagttataaacttgcaaagagg
gtgtcctcgcagcatcctgaactctctaaagaacttgcagcgattccttacgtggatgtt
gctgtgataaatctttgctataaaacccccgatcttcaaaagcacaagggttttggattt
ctggttccaccgatcgaaaatctgccgattttgggagtgatcttcgacagctgctgcttc
gatatggacgacaatacggttctaaccgttatgatgggcggtgcttggttcgagaagtgg
ttcggaagtaatcccgacgaagagctgcttctagacgtggcactgaaaaatgtgaataga
attttggacattcaacaagcgccggatgcgtacaaggtgaaccttttgaggaaatgcatt
ccacagtacgtggttggccaccataagcgagtggaagccataagagcttacattcgtgat
cacaaactgccactagggttgtgtggagcttcgtacgatggcgtaggagtcaacgacgtg
attctgtctgccaggaaatgcgttgaagaacaggttaaaagcaaataa

DBGET integrated database retrieval system