KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL003993Help
Entry
AaeL_AAEL003993   CDS       T01053                                 

Definition
cyclohex-1-ene-1-carboxyl-CoA hydratase, putative
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:aag01200]
Metabolism; Overview; Fatty acid metabolism [PATH:aag01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aag00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:aag00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:aag00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:aag00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:aag00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aag00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:aag00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:aag00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 292 aa AA seqDB search
MANIGKIFASRTYTLAKAAQANNVRFYCAASPKAFEYIKTELVGEKKNVALITLNRPKAL
NALCNGLMNEVSQALDQFDSDDNVGAIVITGSEKAFAAGADIKEMQNNTYAKCITGNFLN
NWTSVAKAQKPVIAAVNGYALGGGCEFAMMCDIIYAGDKAKFGQPEIALGTIPGAGGSQR
TTRVMGKSKAMEMCLTGNMINAEEAERSGLVSKVFPADKVVSEAVKLGEKISTFSPLIVQ
LCKEAVNTAYETTLNEGLKFERRHFHATFSTKDRLEGMTAFVEKRAPKFTNE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggccaacattggaaaaattttcgcttccaggacatacactctggctaaagccgcacag
gccaacaatgtacgattctattgcgctgcttccccgaaggcgttcgaatacattaaaacc
gagcttgtcggtgagaagaaaaatgtcgctctgatcacgctgaatcgtccaaaagctctg
aatgctctgtgcaatggtttgatgaatgaagttagccaggctttggaccagtttgacagt
gacgacaatgtaggagccatcgtcatcaccggcagcgagaaggcctttgcagctggtgcg
gacatcaaggagatgcagaacaacacgtacgctaagtgtatcaccggtaactttctcaat
aactggactagcgttgccaaggcccaaaaaccggtcattgctgctgtaaatgggtacgct
ttgggcggtggctgcgaattcgctatgatgtgcgatatcatctacgctggagataaggcc
aagtttggccagcctgaaatcgcgctcggaactattcctggagccggtggttcccagcgt
actacccgtgttatgggcaagtcgaaggccatggaaatgtgcttgactggaaacatgatc
aacgctgaggaagctgaacgatcgggattggtcagcaaggtcttcccggctgataaggta
gtcagcgaagccgtcaagctaggagaaaagatttccacattctcgccattgattgtgcaa
ttgtgtaaggaagctgtgaacactgcttatgaaactacgctgaacgaaggattgaagttt
gagagacgccacttccacgctaccttctccactaaggatcgcctggaaggcatgaccgca
ttcgtcgagaagcgtgctcctaaattcaccaatgaataa

DBGET integrated database retrieval system