KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004221Help
Entry
AaeL_AAEL004221   CDS       T01053                                 

Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AaeL_AAEL004221
Enzymes [BR:aag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AaeL_AAEL004221
Glycosyltransferases [BR:aag01003]
 Polysaccharide
  Storage polysaccharide
   AaeL_AAEL004221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 695 aa AA seqDB search
MSRRFSRAESSSDLLAFLDRGHSANTENRWTFEIAWEVANKVGGIYTVIRSKAFVSTEEL
GDQYCLIGPYKEASARTEVEACEFPNNGPLYGAVSAMRNQGYKVHCGRWLVDGNPQIILF
DVGSAAWKMDGYKQELWESSNVGIPHLDVESNDAVILGYTIATFIAEFKRCAEQYSHDNE
YGPPRIVAHFHEWQAGVGLIALRTRHVDVATVFTTHATLLGRYLCAGNTDFYNNLDKFPV
DEEAGKRQIYHRYCLERAATHLCHVFTTVSEITGYESEHLLKRKPDIITPNGLNVKKFSA
IHEFQNLHAMAKEKIHEFTRGHFYGHFNFDLEKTLYMFIAGRYEFSNKGADIFIESLARL
NHLLKSHNPDVTVVAFLIFPAKTNNFNVESLRGHAVTKQLRETLNTIQQQIGKRMYDTCL
KGHLPDGGEILTKEDMVKIKRCLYALQRDGNPPVTTHNVVDDWNDPVLESVRRCHLFNTK
YDRVKIVFHPEFLNSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTT
NLSGFGCFMQEHIADPKSYGIYIVDRRHVGLEESVQQLSKFMFEFCKLNRRQRIIQRNRT
ERLSDLLDWRNLGIYYRQARIKALQTVYPDYVDESESYLRRAADFNYPRPVSAPPSPSSS
RHTTPAPSLHGSDDEQDSVDSEEELEELKKANSHD
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggcgcttttcgcgagcagagtccagctcggacctgctggctttcctggaccgt
ggccactctgcgaatactgaaaatcgatggacttttgaaattgcatgggaagtcgccaat
aaggtgggtggaatctacaccgttattcgctccaaagcatttgtgtcgacggaagaactt
ggcgatcagtattgcctgattgggccatacaaagaagcatctgcccggacggaagttgaa
gcatgtgagtttccgaacaatgggcccctgtatggagcagtgtcagcaatgcgaaatcaa
ggctacaaggtacactgcgggcggtggctagtcgatggaaaccctcaaatcattctgttc
gacgttggatcggcggcctggaaaatggatggctacaagcaggaactgtgggaatcatca
aacgttggaataccgcatttagacgttgagagcaatgatgccgttattcttggctatact
atcgccacctttattgccgagttcaaacgttgcgctgaacaatactcgcacgacaatgaa
tacggaccaccgcgtattgtagcccatttccatgagtggcaggccggcgttggtctaatt
gctctgcgaacgcgccacgtagatgtcgccactgtgttcacaactcacgctactttgttg
ggtcggtatctgtgtgctggtaatacggacttttacaataatctagacaaattccctgtc
gatgaggaagccggaaaacgacagatttatcatcgttattgtcttgaacgtgctgctact
catctctgtcatgtgttcactactgtctcggaaattaccggttatgagtcggaacatttg
ctgaagcgaaaacctgatattatcacgcccaacgggttgaacgtgaaaaagttttctgct
atccacgaattccagaacctacacgccatggcaaaggaaaagatccatgagtttaccaga
ggccatttctacggtcacttcaactttgatttggagaagactttgtacatgtttattgcc
ggtcgctatgagttctcgaacaagggtgctgacatctttatcgagtccctggctcgattg
aatcacttgttgaaatcacacaatccggatgtaaccgtagtggcattcttaattttccct
gccaagaccaacaacttcaacgtagagtcacttcgtggacatgccgttaccaagcagcta
cgcgaaactcttaacaccattcagcagcagataggaaagcgaatgtatgacacttgcctg
aaaggacatctgcctgatggaggcgaaattttaactaaggaagacatggtcaagatcaaa
cggtgtttgtacgctctgcagcgcgatggaaatccaccggtaaccactcacaacgtcgtc
gatgactggaatgatcccgtcctggagtcagtacgacggtgccatctgttcaacacgaaa
tatgatcgtgttaaaatagttttccaccctgagtttttgaactccaccaatccattgttt
ggactggattacgaagagtttgttcgcggttgccatttgggcgtatttccctcatactac
gaaccatggggctacacaccagccgagtgtaccgtgatgggaattccaagtgttacaact
aacctctctgggttcggttgtttcatgcaggagcacattgccgaccctaagtcgtatggt
atttacattgtggatcgacgtcacgtgggactcgaggagagcgtccaacagctgtccaag
tttatgttcgagttctgcaaactcaaccggcgccagagaatcatccaacgaaaccgaact
gagcggcttagcgatctgcttgattggagaaatctaggaatttattaccgccaggctaga
ataaaagcgttgcaaaccgtgtatccagattacgtcgatgaatcggagagctatctgagg
cgagctgctgacttcaattaccctcgtccagttagtgccccaccaagtccaagttcttcc
aggcacacaacgccagctccatcactacacggatcggacgatgaacaagattccgttgat
tctgaagaagaattggaagaactgaagaaagctaactcgcatgactaa

DBGET integrated database retrieval system