KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004294Help
Entry
AaeL_AAEL004294   CDS       T01053                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AaeL_AAEL004294
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AaeL_AAEL004294
   00020 Citrate cycle (TCA cycle)
    AaeL_AAEL004294
   00620 Pyruvate metabolism
    AaeL_AAEL004294
Enzymes [BR:aag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AaeL_AAEL004294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 503 aa AA seqDB search
MLRTIAVRNEKLLLQGSRKVLRGTASRALSCEAARKCTVQKNSQKWTSTGSQMASLWQVN
FVRGYCSNYPAHNKVLLPALSPTMELGTIVSWEKKEGDKLNEGDLLAEIETDKATMGFET
PEEGYLAKILVPAGQKDVPIGKLVCIIVENEADVAAFKDYKDTGAPAAKPAAPAPPAAAA
APPVPTPPPVAAAPPPMAAAPAPMTAVEQRGPRVYASPMAKKLAEQQRLRLEGRGSGLYG
SLTSKDLAGLQAAGAPEARAAAAGAPSVPAGAAYVDIPVSNIRGVIAKRLLESKTTIPHY
YLTVDVNMDKINKLRSKFNKQLENDGVKLSINDFIIKAAALACKKVPEANSAWMDTVIRQ
FDAVDVSVAVSTDRGLITPIVFSADRKGLSDISKDVKNLAAKARDGKLQPQEFQGGTFSV
SNLGMFGVTHFCAIINPPQSCILAVGGTQKRIVPDKDSEQGWKESDYVAVTLSCDHRTVD
GAVGARWLQHFRQFLEDPHSMLL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaaccatcgccgtaaggaatgagaagctcctgctccagggatcccgcaaagtt
ctccggggaactgccagcagggcgctaagctgcgaagccgcccggaagtgcactgtccaa
aaaaactctcaaaaatggacttcaacgggatcccaaatggcctcgctatggcaggtgaac
ttcgtccgtggttactgcagtaactatccagcccacaataaggtccttctgccagcgctt
tcacccacaatggaactcggtaccatcgtcagctgggagaagaaggaaggcgacaagctg
aacgaaggtgatctcttggccgaaatcgaaaccgataaggccaccatgggattcgaaact
cccgaagaaggttacctggccaaaattttagtgccagccggtcagaaggacgttcccatt
ggtaagctggtgtgcatcattgtcgagaacgaagcggacgtcgctgccttcaaggactac
aaagacactggtgctccagcagccaagcctgctgcccctgctccaccagcagctgcagct
gcacctccggtaccaactcccccaccggttgcggctgcaccgccaccaatggcagctgcc
cccgcaccgatgaccgccgttgaacagcgtggaccccgggtctacgctagtcctatggcc
aagaaacttgctgaacagcagcgactacgattggaaggccgaggatccggtctttatggc
tcactaacgtctaaggatcttgcaggtctgcaggcggctggtgcaccagaagcccgtgct
gcagcggcaggagcacccagcgttccggccggggcagcctacgttgatattccggtgtcg
aacattcgtggagtgatcgccaagcgattgcttgaatcgaagaccaccattccacactac
tacctcacggtggacgttaacatggacaaaatcaacaagctgcgatccaagttcaacaaa
cagctggagaatgatggcgtgaaattgtcgatcaacgatttcatcatcaaagcagctgcc
ttggcttgcaaaaaggttcctgaggcgaactccgcatggatggacactgttatcagacag
ttcgacgccgtggatgtttcggtggcagtttctacagatcgtggtctcattacgcctatc
gtgttcagtgccgatcgtaagggactgtccgatatttctaaggatgtcaagaacctggcg
gctaaggcgcgggacggtaaattgcaacctcaggaattccagggtggtaccttcagcgta
tccaatctcggcatgttcggcgtgacgcacttctgcgccattatcaaccctccgcagagc
tgtattctggcggttggtggcacccagaaacggatcgtacctgataaggattcggaacaa
ggctggaaagagagtgactacgtagcggtaactctgagctgtgatcatcgcacggtggac
ggcgctgtcggtgctcgctggttgcagcatttccgtcagttcctagaagatccccattca
atgctgctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system