KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004294Help
Entry
AaeL_AAEL004294   CDS       T01053                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:aag01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aag00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aag00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aag00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 503 aa AA seqDB search
MLRTIAVRNEKLLLQGSRKVLRGTASRALSCEAARKCTVQKNSQKWTSTGSQMASLWQVN
FVRGYCSNYPAHNKVLLPALSPTMELGTIVSWEKKEGDKLNEGDLLAEIETDKATMGFET
PEEGYLAKILVPAGQKDVPIGKLVCIIVENEADVAAFKDYKDTGAPAAKPAAPAPPAAAA
APPVPTPPPVAAAPPPMAAAPAPMTAVEQRGPRVYASPMAKKLAEQQRLRLEGRGSGLYG
SLTSKDLAGLQAAGAPEARAAAAGAPSVPAGAAYVDIPVSNIRGVIAKRLLESKTTIPHY
YLTVDVNMDKINKLRSKFNKQLENDGVKLSINDFIIKAAALACKKVPEANSAWMDTVIRQ
FDAVDVSVAVSTDRGLITPIVFSADRKGLSDISKDVKNLAAKARDGKLQPQEFQGGTFSV
SNLGMFGVTHFCAIINPPQSCILAVGGTQKRIVPDKDSEQGWKESDYVAVTLSCDHRTVD
GAVGARWLQHFRQFLEDPHSMLL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaaccatcgccgtaaggaatgagaagctcctgctccagggatcccgcaaagtt
ctccggggaactgccagcagggcgctaagctgcgaagccgcccggaagtgcactgtccaa
aaaaactctcaaaaatggacttcaacgggatcccaaatggcctcgctatggcaggtgaac
ttcgtccgtggttactgcagtaactatccagcccacaataaggtccttctgccagcgctt
tcacccacaatggaactcggtaccatcgtcagctgggagaagaaggaaggcgacaagctg
aacgaaggtgatctcttggccgaaatcgaaaccgataaggccaccatgggattcgaaact
cccgaagaaggttacctggccaaaattttagtgccagccggtcagaaggacgttcccatt
ggtaagctggtgtgcatcattgtcgagaacgaagcggacgtcgctgccttcaaggactac
aaagacactggtgctccagcagccaagcctgctgcccctgctccaccagcagctgcagct
gcacctccggtaccaactcccccaccggttgcggctgcaccgccaccaatggcagctgcc
cccgcaccgatgaccgccgttgaacagcgtggaccccgggtctacgctagtcctatggcc
aagaaacttgctgaacagcagcgactacgattggaaggccgaggatccggtctttatggc
tcactaacgtctaaggatcttgcaggtctgcaggcggctggtgcaccagaagcccgtgct
gcagcggcaggagcacccagcgttccggccggggcagcctacgttgatattccggtgtcg
aacattcgtggagtgatcgccaagcgattgcttgaatcgaagaccaccattccacactac
tacctcacggtggacgttaacatggacaaaatcaacaagctgcgatccaagttcaacaaa
cagctggagaatgatggcgtgaaattgtcgatcaacgatttcatcatcaaagcagctgcc
ttggcttgcaaaaaggttcctgaggcgaactccgcatggatggacactgttatcagacag
ttcgacgccgtggatgtttcggtggcagtttctacagatcgtggtctcattacgcctatc
gtgttcagtgccgatcgtaagggactgtccgatatttctaaggatgtcaagaacctggcg
gctaaggcgcgggacggtaaattgcaacctcaggaattccagggtggtaccttcagcgta
tccaatctcggcatgttcggcgtgacgcacttctgcgccattatcaaccctccgcagagc
tgtattctggcggttggtggcacccagaaacggatcgtacctgataaggattcggaacaa
ggctggaaagagagtgactacgtagcggtaactctgagctgtgatcatcgcacggtggac
ggcgctgtcggtgctcgctggttgcagcatttccgtcagttcctagaagatccccattca
atgctgctgtaa

DBGET integrated database retrieval system