KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004383Help
Entry
AaeL_AAEL004383   CDS       T01053                                 

Definition
hypothetical protein
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aag00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 685 aa AA seqDB search
MHSRLLMLFWRRKLLLLASSLLFLVALWFWGFLYTTHVSDGGKIVSVKELMMGASGSGGA
NGPHHESLLQRLGFYDDDSLDDGPEDGGAGGVKFVRPTSHSVNRIRGKLIDGWESILQDR
DGKPSNSKQEQVKRKSAEELRIAVEKQNHYEHELKKMGVPVIAGLGPGGHPPPVQRLVHL
DLKGAPPKVSYLKRLMPIMKTLGATGILLEYEDMFPYSGVLSSISAKNAYSKDDILEILK
TAFSLGLNVIPLVQTFGHLEFVLKLQEFQHLREVEDAPQAICPSQNASTVFLEEMLDQVI
EFHTPSQNVNLLHKDDIEKLTPKLTHIHIGCDEVYQIAQCNRCRNRQKDLLFLDHIYNVA
TMIRKKWPHLKIIIWDDMLRHMSLDTLQTSGIGKLVEPMIWVYAEDIYKFIQSSTWDKYA
NVFNTAWAASAFKGAHGEALLLPPIRRHLENTLRWLAVMQGEGTRFSHGIQGLALTGWQR
YDHFAILCELLPSALPSLAVCLSTASRGYFDVNPKTNPVLSSLTCPEPTSDRHAWVELHK
DSMLSTFSRCMFPGSVIYRFMLRLMTLMTEAKEYIDEVKNKRGWLTEYNIRHNFSAGTRV
DDLLGEDYHLLNSITNLARNAASTLADVYDHWTSGEFIEQRIFPILSELKNLERIGESLK
KRKTWPQRPLPYLKPFDALGIDEKT
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgcattctcgtctgctgatgctgttttggcgcagaaaactactgctgctcgcttcgtcg
ctgctttttctggtggccctctggttctgggggtttctctatacaacccatgtaagcgat
ggcggcaagatcgtttcggtgaaggaactgatgatgggtgccagcggaagcggcggcgcg
aatggaccacaccacgaaagtcttctgcaacggttgggtttctacgatgacgattctttg
gacgacggaccagaagatggaggggctggtggggtgaagttcgttagaccgacgagtcat
tcggtgaataggataagagggaaactcatcgatggctgggaaagtattctgcaagatcgg
gacgggaagccgagtaattcgaaacaagagcaagtgaagcgaaagtctgccgaagagctg
cgaatcgctgtcgaaaaacagaatcactacgaacacgagcttaagaagatgggtgttccg
gttatcgccggactcggacccgggggtcatccacctcccgttcagcgattggttcacctg
gatctcaaaggagcaccaccgaaagtatcctacttgaaaagactgatgccaatcatgaag
accttgggagctaccggaattctactggaatacgaagacatgttcccgtacagcggtgtt
ctttcttcgatatccgcaaaaaatgcttacagtaaagacgacatcttggagattttgaaa
actgctttcagtttgggactcaatgtcattccattggtacaaacttttggccatttggag
ttcgtgctaaaattacaagaattccaacatctccgagaggtagaagatgcccctcaggca
atatgtcccagtcagaatgcttcaacggtattcttggaggagatgcttgatcaagtgatt
gagtttcatactccttcacaaaatgtcaatcttctgcacaaagacgatatagaaaagctc
acccctaaattgacacatatccacattggttgtgacgaggtgtaccagatagcgcaatgc
aatcgatgcaggaatcgccagaaggatcttctattcctggatcacatctacaatgtagcc
acgatgatccgcaagaaatggccgcacctgaaaatcatcatatgggacgacatgttgcgg
cacatgtcccttgatactctgcaaacatccgggatcggaaaactcgtggagccgatgatc
tgggtctacgctgaagacatctacaagttcatccagtcgtccacctgggacaagtatgcc
aacgtcttcaacacagcttgggctgcatcagccttcaagggagctcatggagaagctcta
ctacttccaccgattcgccggcatctggaaaacacactccgctggctggcggtgatgcaa
ggagaaggaacacggttcagtcatggtatccaaggccttgctttgaccggatggcagcgg
tacgatcattttgcgatactctgtgagctacttccaagcgctcttccatccctagcagtt
tgcctatcaacggcctcgcgtgggtacttcgatgttaacccaaaaacgaatcccgtactg
agtagccttacctgtccggaacccacgagtgatcgacacgcatgggttgaactgcacaaa
gattcgatgctgtctacgttttcgaggtgtatgttcccgggcagtgtgatctatcgattt
atgctcagactaatgacgctcatgaccgaagccaaagaatacatcgacgaggtgaagaac
aaacgcggttggttgacggaatacaacataaggcacaacttttctgcggggacccgtgtg
gatgatcttctcggggaagactaccatctactgaattcgataaccaatctagcgaggaac
gctgcctcgacgttggccgatgtttatgatcactggacatccggtgagttcatcgagcag
cgcatctttccgatactctccgagttgaagaacctggaacgtatcggggaatcgctgaag
aagcggaaaacgtggccccagcgtccactgccatacctgaagccattcgatgcactggga
attgacgaaaaaacctag

DBGET integrated database retrieval system