KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004457Help
Entry
AaeL_AAEL004457   CDS       T01053                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AaeL_AAEL004457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 108 aa AA seqDB search
MGIPAGDVEKGKKLFVQRCSQCHTVEAGGKHKVGPNLHGIFGRKTGQAAGFSYTDANKAK
GITWSEDTLFEYLENPKKYIPGTKMIFAGLKKPNERADLIAYLKSSTA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtattccagctggagacgttgagaagggaaagaagctgttcgttcagcgatgctcg
cagtgccacactgtggaagctggcggcaagcacaaggtcggaccgaacctgcacggaatc
ttcggtcgcaaaactggccaagccgccggattctcctacacagatgccaacaaggccaag
ggtatcacctggagtgaagataccctcttcgagtatctggaaaacccaaagaagtacatc
cctggcacgaagatgatcttcgctggcctgaagaagcccaacgagcgtgccgatctcatc
gcttacctgaaatcgtctaccgcctaa

DBGET integrated database retrieval system