KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004566Help
Entry
AaeL_AAEL004566   CDS       T01053                                 

Definition
myo inositol monophosphatase
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AaeL_AAEL004566
  Energy metabolism
   00920 Sulfur metabolism
    AaeL_AAEL004566
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AaeL_AAEL004566
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AaeL_AAEL004566
    3.1.3.25  inositol-phosphate phosphatase
     AaeL_AAEL004566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 345 aa AA seqDB search
MNLGGSIRINKFGVLIIAILLVFLVYYISTGKSRSSNYALNKNPNEVNLRKLLIGSIQAA
QRGGFEVVEVSKSPDFNVHSKGKTKEGANDPVTDADFRSHCVMASGLHRIFPKLKIISEE
DGGNKPCPDSKLFDLDPTVIHENSNVPDEIVGIEDVTVWIDPLDATQEYTENLFQYVTTM
VCVAIKGVPTIGVIHNPFTKKTVWAWTNKAVSEPLSYIKRDEDVKHPVVIVSRSHSGDVK
NLAKEVFGENLHIIPAGGAGYKVLQVLHNNATAYLHSTAIKKWDICAGNAILAAIGGKMT
TQKNEDISYSDKDSFLNENGLLATAVENIHEMYIKKLIDHQKMSR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaggtggctcaattcgaatcaataaatttggcgttctcataatcgcaatactg
ttggtctttctggtttactacatatcgaccggaaagtctcgaagctcaaactacgcattg
aacaaaaatcccaatgaagtgaacctgcggaaacttttgatcgggtcgatacaggccgcc
cagcgtggaggcttcgaggtggtagaggtttccaaaagtcccgacttcaatgttcacagc
aagggcaaaaccaaagaaggggccaacgatccggtgacggatgcagactttcgctcacat
tgtgtcatggccagcgggctgcaccgaatttttccaaagctgaaaatcatctccgaagag
gacggggggaataaaccctgtccggattcgaagctgttcgatctggatcctacggtgata
cacgaaaattccaacgtgccggatgaaattgtaggaattgaagatgtcacagtgtggatc
gatccactggatgcaacacaggagtacactgagaacctgttccagtatgtgacaactatg
gtgtgcgtggcgataaagggcgttccgacgatcggagtaattcacaacccattcacgaag
aaaaccgtttgggcctggacgaacaaggccgtctcggaaccactgagttatatcaagagg
gacgaagacgtcaagcatcctgtcgttattgtctcccggtcccacagtggtgatgtgaag
aacctcgccaaggaggtgtttggagaaaatctgcatattatcccagcaggaggagcagga
tacaaggtcttgcaggtactgcacaacaatgcaacggcgtacctccactcaacggccatc
aaaaagtgggacatctgcgctgggaatgcaattctcgctgccattggaggcaaaatgacg
acgcagaaaaatgaggatatttcctacagtgataaggattcgttcctcaacgaaaatggc
cttttggcgacggccgtcgagaacatacacgagatgtacatcaaaaagctgatcgaccat
cagaaaatgagtcgttaa

DBGET integrated database retrieval system