KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004582Help
Entry
AaeL_AAEL004582   CDS       T01053                                 

Definition
beta-galactosidase
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AaeL_AAEL004582
  Lipid metabolism
   00600 Sphingolipid metabolism
    AaeL_AAEL004582
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AaeL_AAEL004582
   00604 Glycosphingolipid biosynthesis - ganglio series
    AaeL_AAEL004582
   00511 Other glycan degradation
    AaeL_AAEL004582
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AaeL_AAEL004582
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AaeL_AAEL004582
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AaeL_AAEL004582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 553 aa AA seqDB search
MTYIEWSTHEPKEGQYVWDGIANLEQFIQIAQEEDLYVILRPGPYICAERDMGGFPYWLL
TKYPDVKLRTYDLDYLREVEKWYGVLMPRIQNHLYKRGGPVIMVSIENEYGSFSACDGRY
LSFLRNLTESYIQNEAVLFTNDGPDQLPCGRIPGVLATLDFGSVGNPDSYWQKLRKYQAK
GPLVNAEFYPGWLTHWMEPLAQVATGPVVSQLRRMLQQGANVNFYMFHGGTNFAFTAGAN
DGGPGRFNTDITSYDYDAPLDEAGDPTSKYFAIRNTILEFLPDPGVSVPSKLPKMNLPPV
KMNRLGSLLSEQARQILAKYSLSSRRPLGFEALNQHSGLILYETQIPKALHHSDPLTIRV
DTLHDRAYVHVDNKFVGILSRETATYSMPIRLESGTAKLQLVVENQGRINYNIANDKKGI
LGAVTLNGTELLNWSMTGFPLENYSQLENYIDQFSGLEETTGSVKIFHGEFNITTDNIYD
TYFDPRGWGKGVVFINGFNLGRYWPLAGPQITLYVARHILIQGKNTIVVIEYQKEVMQGT
LINFRDQAILNGP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacatcgagtggtctacacatgagcctaaagaagggcagtatgtttgggatgga
attgcaaacttggagcagttcatacagattgcccaggaggaagacctatacgtcatcctc
cgaccaggaccgtatatttgcgctgaacgagatatgggtggctttccctactggcttctc
accaagtatccagatgtgaagcttcgaacctatgatctagactacctacgggaagtggaa
aagtggtatggagtcctgatgccgcggattcaaaaccatttatataaacgaggaggacca
gttataatggtgtcgatagaaaatgaatatggatcgttctccgcatgtgacggtcgatat
ttgtctttcctcagaaatttaacagaaagttacatccaaaatgaagcagtgctctttacc
aacgatggaccggatcaactgccatgcggaagaatcccaggcgtactggcaacacttgat
tttggatctgttgggaaccccgacagttattggcaaaagcttcgcaagtaccaagcaaaa
gggccattggtaaatgcagagttttatcctggttggcttacccattggatggaaccattg
gctcaagttgccaccgggcccgtggtgagtcagttacgcagaatgcttcaacagggagcg
aacgtcaacttctatatgttccatggaggaaccaactttgcgttcacggcgggagctaat
gacggcggacctgggagattcaatactgatatcacttcctacgactatgatgccccctta
gacgaagccggcgatcctacatctaagtatttcgctattaggaacaccatattagagttt
cttccggatcctggtgtgtctgtaccgagcaaacttccgaaaatgaaccttccaccagtg
aagatgaaccgtctaggctcgcttctatcagagcaagcacgacagattctggcaaagtat
tcattgtcgtcacgacggccgttgggattcgaagccctaaatcaacattcagggttgatt
ttgtatgaaacacaaatacctaaagctctgcaccactcggatcccttgactattagggtt
gacactctacacgatcgcgcttatgttcacgtagataacaaattcgttggaatcctatca
cgtgaaactgctacgtactcgatgccgatcagacttgaatcaggaacagctaaacttcaa
ctggtggtggagaatcaaggccgtatcaactacaacattgcaaacgacaagaaaggtatc
ctgggtgcagttactctgaacggcacggaactacttaactggagcatgacaggctttcca
cttgaaaactactcgcagttggaaaattatatcgaccagttcagcggtttggaggaaact
accggctcagtgaaaatattccatggtgaattcaatattactaccgataatatctacgat
acatattttgacccgagaggatggggaaaaggagtagtgttcatcaatggattcaattta
ggaagatattggccattagcaggaccgcaaataacgctctatgttgcacgacatattttg
attcaagggaaaaatacgatcgttgtaattgaatatcagaaggaggtaatgcagggtact
ttaatcaactttagagaccaagctattctcaatgggccctag

DBGET integrated database retrieval system