KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004639Help
Entry
AaeL_AAEL004639   CDS       T01053                                 

Definition
histone deacetylase
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AaeL_AAEL004639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
1
AA seq 358 aa AA seqDB search
MCLKLSCSSNMSSVEDEDEDGQRDGKRPEDGQNLRSGDKLPIVYRPEYGVEFCGLQRLHP
FDAAKGGNIYRLLKAGKLISSDSDVHRPREISTDELLDVHTKRYIESLKWSINVAKIAEI
PPLIFVPNYFVQRSYLRPMRYQTFGSILAARCALDGSCGTGWAINLGGGFHHCSADDGGG
FCPYADITLIVRMLQSSGKGIERIMIVDLDAHQGNGYARDLMDDSGVFIMDMYNYRIYPR
DHEAKLAIKRAVELKPHVGDEEYLRKLRTNLALSFDEFRPNFLIYNAGTDVLKGDPLGIL
DITGQGVIERDEIVFEMARDRGVPLVMLLSGGYLRSSARVIADSILNLHAKDLLPVAK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttgaagctgagttgctcgtcgaacatgagttccgtggaggacgaagacgaggac
ggccaacgagatgggaaacgcccagaagatgggcagaatctacgcagcggcgataagctc
ccgattgtttaccggccggaatacggagtggagttttgtggcctccagcggctgcatccg
ttcgatgcggccaagggtggaaacatataccggttgttgaaagccgggaaactgattagc
agcgacagcgatgtccaccgaccccgggaaataagcaccgatgaactgctggacgttcac
accaagcgatacattgagagtttgaagtggagcatcaatgttgccaagatagcggagatt
ccaccgttgatattcgtgccaaattatttcgtccagcgaagctatctgcgtccgatgagg
taccagacgttcggatcgatactggccgccaggtgcgccttggacggttcttgcggcacg
ggatgggccatcaatctgggtggagggtttcatcattgcagcgcggacgacggtggcgga
ttttgtccctatgcggacattacgttgatcgtccggatgttgcagtccagcggcaaggga
attgagcggataatgatcgtagatttggacgcccaccagggaaatggttatgctcgggac
ctaatggatgacagtggggtgttcataatggatatgtacaactaccggatctacccgagg
gatcacgaggcaaagctggcgatcaagagagccgttgagctgaagccccacgttggggac
gaggaatacctgcggaagttgagaaccaatttggcactttccttcgatgagtttcgaccg
aacttcctgatctacaatgctggcaccgatgtgctgaaaggggacccgttgggaatactg
gacataaccggccagggagtgatcgagagggacgagatcgttttcgaaatggcgcgggat
cggggagttccgttggtgatgctcctcagcggaggctaccttcggagctcggctcgggtc
attgcggattcgattctcaatttgcacgccaaggatttgttaccggtggcaaagtga

DBGET integrated database retrieval system