KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004661Help
Entry
AaeL_AAEL004661   CDS       T01053                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aag00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:aag00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:aag00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:aag00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aag00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aag04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 616 aa AA seqDB search
MKSSGSLHVILGVSFVTVVVVAIYFAAANYTGGKSESQSAPVWGYRCVNSRCQKVALDGA
SGSESKAVSLSVCRLYCDGEFGTVWPRPTGDFRLGNNLIRVNPGAIEFQWGKRYEALNKY
WGGSVERFRDQLLKKAAGEEIRSGGKKVAVKVDVGGDSLVLNHETDESYKLAIHGGEDDQ
VQVTIEAANYFGARHALETLAQLMVFDDIRNELQVVADVEIQDAPVYPHRGLALDTSRNY
VSVAAIKKTIDALAMVKMNVFHWHITDSQSFPLVIKSQPTLHTFGAYSRKQIYTAANVQD
IVQYALTRGVRVIPELDAPAHVGEGWEKTNLTTCFNFQPWTKYCVEPPCGQLDPTKDKVY
DVLEDIYREMNDMFTHSDVFHMGGDEVSLSCWNSSVEVQQWMKAQGWGLQEVDFLKLWNH
FQTNALQRLDKSLKDNRPIVMWTSRLTEEPYVDQYLDKDRYIIQIWTTGDDPKIAALLEK
GYKLIMSNYDALYLDCGFAGWVQGGNNWCSPYIGWQKVYNNDLKSLGGQYSSQILGAEGA
LWTEQADHHSLDGRFWPRVSALAERLWTDPREGWQSADSRMLVHRERLVENGIAAESLQP
QWCLQNEGECPIVQNP
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatccggttcattgcacgtgattcttggagtgtccttcgtgaccgtcgttgtc
gtagcaatttactttgccgcagccaattatactggagggaagtcagagtcgcaaagcgct
ccggtgtggggttaccgatgcgtcaacagtcgctgccaaaaggtggccctcgacggcgct
tcaggaagcgagtcgaaagccgttagcctgtcggtgtgccgtctgtactgcgacggcgag
tttggcacagtatggcctcgaccgaccggtgacttccgactgggtaacaacctgatccgg
gtgaatccgggagcgatcgagtttcagtggggtaagcgatacgaagcgttgaacaagtat
tgggggggtagcgtggagcgattccgggatcagttgctaaagaaagcggcaggggaggag
atcaggtccggtgggaagaaggtagcggtgaaggttgacgttggtggagactcattggtg
ctgaaccatgaaaccgacgaaagttacaagttggcaattcatggcggtgaggatgatcaa
gtgcaggtgacgatcgaggctgctaattacttcggagcgcgacatgctctggaaaccttg
gctcagttgatggtcttcgacgacatccgcaacgagctccaagtggtagctgatgtcgag
atccaagatgctccggtttatcctcaccgaggcttggcgttggatacatccagaaattac
gtcagtgtcgctgcgatcaagaagacgattgacgctttggccatggttaagatgaatgtg
ttccactggcatattacagattcgcagagtttccctctggtcataaaatcgcaaccaact
ctacacacgtttggagcgtattctagaaagcaaatctacactgcggctaacgttcaggac
atcgtccagtatgctctgacccgtggagttcgagtcattccagagttggatgccccggcc
catgtcggagaaggttgggagaaaaccaatctgaccacctgtttcaacttccaaccgtgg
accaaatactgcgttgagcctccctgcggtcagttggatcccacgaaagacaaggtatac
gacgttctggaggacatctaccgcgagatgaacgacatgttcacacactctgatgtgttc
cacatgggtggcgacgaagtctcgctcagctgttggaactccagcgttgaagttcaacaa
tggatgaaggctcagggctggggtcttcaagaagtcgatttcctgaaattgtggaaccac
ttccagacgaatgccctccaacgcttagacaaatcgctcaaggacaaccgtccgatcgtg
atgtggacaagtcgcttgacagaggaaccctacgtcgaccaatacctggacaaggatcgt
tacatcatccaaatctggaccaccggtgacgatccgaagattgctgccctgctcgagaag
ggctacaaactgatcatgtccaactacgacgctctttatctggactgtggcttcgctggt
tgggttcagggtggtaacaattggtgttcgccttacatcggatggcaaaaggtctacaac
aatgatctaaaatcgctcggtggtcaatactcgtcgcagattctcggagctgaaggagct
ctttggactgaacaggccgatcaccactcgctggatggacgcttctggccacgagtcagt
gccctggccgaacgtctttggacagatccccgcgagggctggcaatcggccgactcacga
atgctggtccatcgagagcggctggtcgagaatggaatcgccgccgaaagcttacagccc
cagtggtgtctgcaaaacgagggcgaatgcccgatcgtgcaaaacccgtag

DBGET integrated database retrieval system