KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004853Help
Entry
AaeL_AAEL004853   CDS       T01053                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aag00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 517 aa AA seqDB search
MSHTNKFGDLVGSIDEGTSSARFILFRAETSDIVCFHQKELRQMYPQEGWVEQDPKEILS
VVEECIEKTIEKLQELGGSPTDIVAVGVTNQRETTIVWDKTTGEPLYNAIVWLDMRTAST
VDQLLETVPNKTRNKNYLKPLCGLPLSPYFSAVKLRWLIDNVPKVKTAIKNGNCLFGTVD
TWLIWNLTGGVNGGAHVTDVTNASRTMLMNIETLHYDRTLGKFFDIPFEILPEIRSSSEV
YGKICLKALEGVPLSGCLGDQQAALVGQECLVRGKAKATYGTGCFLLYNTGNALIDSSHG
LITTVAYQMGPEAHPTYALEGSVAIAGAALGWLRDNINILTSAKESEELALSVENNGDVY
FVPAFSGLYAPYWNQEARGVICGITEDTQRGHIVRASLEAVCFQVRDILDAMNKDCGIPL
VKLKVDGGMTANSLLTQWQADLIGLEVQRPAVVETTALGAAMAAGRAVGCWDVENVSVES
NCTSFRPKITDDERDMRYSKWKMAVERSFGWESNAMV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacaccaacaagttcggcgacttggttggttccatcgacgagggaaccagctcg
gcacgattcatcctgttccgggcggaaaccagtgacattgtttgcttccaccaaaaggaa
ctgcgccagatgtacccccaggaaggctgggtcgagcaggatccgaaggagatcctgtcc
gtggttgaggaatgcatcgagaagaccatcgagaaactgcaggaacttggtggcagcccg
accgacattgtggccgtcggtgtgaccaatcaacgggaaacgaccattgtgtgggacaaa
acgacgggagaacccctgtacaatgccatcgtgtggttggatatgcgaacggcttccacc
gtcgatcagctgctggaaacggttcccaataagacccggaacaagaactatctgaaaccg
ttgtgtggattgcccctgtcgccatacttttcggcggtcaagttgcgctggctgatcgac
aatgttccaaaggtgaaaacggccatcaagaacggcaactgtctattcgggacggtcgac
acatggctgatttggaatctcaccggcggcgtcaatggaggagcacacgttaccgatgtc
accaatgcatcccgtaccatgctgatgaacatcgaaacgctacactacgataggacgttg
ggcaagttcttcgacattccatttgagatcctgccggagatacggtccagctcggaggtg
tacggcaaaatttgtctgaaggccctagaaggagttccgctaagtggatgcctgggagat
cagcaagcggctttggtgggacaggagtgccttgttcgaggtaaggccaaggccacctac
ggaaccgggtgctttttgctgtacaacactggaaatgcgttgattgactcgtcgcatggt
ttgattacgaccgttgcctatcaaatgggtccggaagctcatccgacgtacgctctggag
ggatctgtcgctatagcgggcgcggctcttggatggttacgcgacaacatcaacattctg
accagtgccaaagaatccgaagaattggcgttgtcggtggaaaacaatggcgacgtttac
tttgtacctgccttcagtggcctctacgctccttattggaaccaggaagcacgtggcgtt
atctgcggaattacggaggatacccaacggggtcacatcgtacgggcgagtctggaagca
gtgtgtttccaagttagggacattttggatgccatgaacaaggattgtggaattccgctg
gtcaaacttaaggttgatggtggaatgaccgccaactcactgttgacccagtggcaggcg
gacttgattgggctggaagtgcaacggcctgccgtggtggagaccacagctttgggcgcg
gcaatggctgcgggtcgtgctgtcggctgctgggatgtggagaacgtcagcgtagaaagc
aactgtacctctttccggccgaagatcaccgacgatgagcgcgacatgagatacagcaag
tggaagatggccgtcgagcgatcgttcggttgggagagtaatgcgatggtgtag

DBGET integrated database retrieval system