KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL004860Help
Entry
AaeL_AAEL004860   CDS       T01053                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AaeL_AAEL004860
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     AaeL_AAEL004860
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     AaeL_AAEL004860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
2
AA seq 183 aa AA seqDB search
MVRAWFMDNESTDQRLEHHLTPPEFLSLEELFNSTGVEYFKINVPTYDSDGVLDGIRKKR
GYSYEDEITCSEKCLPDYENKLKSFFTEHLHTDEEIRFVLDGSGYFDVRNGKDDRWIRIE
VTAGDMIVIPAGIYHRFTLDVKNYIRAKRYFVGEPIWLPYNRPCDDMQCRKDYLQRLEVG
FSA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggttcgagcctggtttatggacaacgagtccaccgatcagcgattggagcatcacctc
actccgccggagtttctgtcgctggaagaactctttaacagcaccggggtcgagtatttc
aagatcaacgtaccgacgtacgactcggatggggtgttggatggcatccggaagaagcgc
ggctatagctatgaggacgagattacttgctccgagaagtgccttccggattacgaaaac
aagctgaagagtttcttcaccgagcacctgcacaccgatgaggagattcgtttcgtgctg
gacggttcgggatacttcgatgttcgcaatggcaaagacgaccggtggatccgaattgaa
gttacggccggagacatgattgtcatccctgccgggatctaccatcggttcacgttggat
gttaagaactacattcgcgctaagcgttatttcgtcggagagcctatctggttaccgtac
aatcgcccgtgtgacgatatgcaatgtcggaaggattatctgcagaggctagaagtggga
ttcagtgcatga

DBGET integrated database retrieval system