KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL005054Help
Entry
AaeL_AAEL005054   CDS       T01053                                 

Definition
pap-inositol-1,4-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AaeL_AAEL005054
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AaeL_AAEL005054
Transfer RNA biogenesis [BR:aag03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AaeL_AAEL005054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
Position
3
AA seq 315 aa AA seqDB search
MASVTAAASAAPLLMRIVASSIQIAGRAGRIIRDVMAKGDLGIVEKGKDDLQTEADRSAQ
RCIMASLQRLFPNVTIIGEEGKSDLKVPEDWLVTEMNSEFLERNACPDGLKQVKESDLVI
WVDPLDGTSEYTQGFLERVTVLIGISVNDRAVGGVIHQPYFKTDNGSLGRTIWGVKGIGA
GGFNLVKPPSDRFIVTTTRSHSNALVQSALDALSPDEVLRVGGAGYKVLQLLEGNAHAYV
FASAGCKKWDTCAPEAVLEAQGGMLTDILGRHYSYGKDVSFPNACGVLGTASGISHQDIL
AKLPDAVKQAMNKTQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgttacggctgcggcgagtgccgccccgcttctgatgcggatagtggccagc
tcgatccagattgcgggccgcgccgggagaatcatccgggacgtgatggccaaaggcgac
ctcgggatcgtcgagaagggcaaggatgacctgcaaaccgaggcggatcgatcggcccag
cggtgcatcatggcctcactgcagcgcctgttcccgaacgtgaccatcattggcgaagag
ggcaaaagcgacttgaaggtacccgaagactggttggtcacggaaatgaacagcgaattc
ctcgagcggaatgcttgccccgatggcttgaagcaggtcaaagaatcagatttggtcatc
tgggtggacccactggatggaaccagcgagtatacgcagggattcctcgagagagttacc
gtactaattgggatttccgtgaatgatcgcgccgttggaggagtcattcatcagccgtac
ttcaaaacagacaacggttcgctgggacgaaccatctggggcgtcaagggcatcggagca
ggtggatttaatctggttaagcctccatcggaccggttcatcgtgacgaccaccagatcc
cattccaatgcactggtgcagtcagctttggacgctctatccccggacgaagtccttcga
gtcggcggagctggctacaaagttctccaactgctggaaggaaatgcccatgcctacgtg
tttgcaagcgctgggtgcaagaagtgggacacgtgtgccccggaagctgtcctcgaggct
caaggaggaatgctgaccgatattctcggccgccattactcgtatggcaaggacgtcagt
ttcccaaacgcttgcggagttctcggaaccgccagcggaatttcacaccaggacatccta
gctaagctaccggacgctgtgaaacaagctatgaataaaacacaatag

DBGET integrated database retrieval system