KEGG   Aedes aegypti (yellow fever mosquito): AaeL_AAEL005175Help
Entry
AaeL_AAEL005175   CDS       T01053                                 

Definition
lipin
Orthology
K15728  
phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AaeL_AAEL005175
   00564 Glycerophospholipid metabolism
    AaeL_AAEL005175
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     AaeL_AAEL005175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1019 aa AA seqDB search
MNSIAKVFNNFKEFYSEINGATLTGAIDVIIVEQPDGSFVCSPFHVRFGKLGVLRSREKI
VDIEINGEPVDIHMKLGESGEAFFVEECLEEDGEVPAHMATSPIPTSSFIEFARDTSIVT
VTQNLEDENIPRPRRNSIDLSKENTESDKSKFENQKSDFNHRRHTDNTTGRPDLTLTKKE
YTTQKIRQEWAEAEQEQIFQMDGIENSTTDWQNSTLLPPNNEEDKHFKPIETVPTSTESK
LTNSELASQEDQQAQLLEDKTNADSKSKKKRRKRSIMKKKNSQRKNSSSSSGGSNHSDPN
DGVETDSITASQPTASSASGSPKEGEPENLTATPAENAPKEIPELSNRGHELDIHFFSDT
EVTAGVSPRQSRPSTPIQSDTEFEISQRENVEGDSMSASWKWGELPTKPEEIEDLSTSQG
KQAQRNSMLSGLMSFMKYNNKKMRKNVPDGLYLSDLDESLDPEVAALYFPPVSSKAQHAQ
TEEDRESGNGTSLPHSPTSLEGVKSLDSDFDDNKDKLSLDFIALSLCGGLDSGTPTYEEF
EKHRLQYADVCNSPTIFSSPDLVVRINDKYCSWQAACPQVMTMLAFQKSLPTEQAETPSK
PKSLDVATAGSVEADAQSTKQQVSQTSSEANRGGRWWYWRRSNDKSTMKTENETEQQSKT
SAIATQTSRSNTPEDVGTMTESFSKTKEDGYNGSLSSEDSELPSDQPTNQELILNKSDSF
IEKYRKTLRLSSEQIESLNLNDGMNEIVFSVTTAYQGTTRCKCYLFKWRYNDKVVISDID
GTITKSDVLGHILPMVGRNWEQIGVAQLFSKIEENGYKMLYLSARAIGQAKTTRDYLQSI
RQGDVKLPDGPLLLNPTSLMSAFHREVIEKKPEQFKIACLSDIQALFPDKNPFYAGYGNR
INDVWAYRAVGIPISRIFTINTKGELKHELTQTFQSTYANMAYIVDQLFPPIKHIEEEDS
EFTSFNYWRDPVPDIDLNLDLSSSSQSGSGSSTPVSLLSGKVTPTSTLVQQALPTIPEN
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtatcgcaaaagtgtttaacaacttcaaggagttctatagtgaaatcaatggt
gctacgctgactggggcgatagatgtaatcatagtagagcagccagatggatcatttgtg
tgttctcccttccatgtgcgcttcggaaagcttggagttttacggagtcgcgagaaaatt
gtagatattgaaataaatggcgaaccggttgacatacacatgaaactaggtgaatctggt
gaagccttttttgtcgaagagtgtctcgaagaagatggtgaagttccagctcatatggca
acctcgccaattcctactagttcgttcattgagttcgctcgcgacacttcaattgtgaca
gttacgcaaaatttagaagatgagaatataccaagaccaaggcgtaattcgatcgattta
tcaaaagaaaataccgaatcagataaatccaaatttgagaatcaaaaatccgatttcaac
catcgacggcacactgataacactacaggaaggcccgatttgactttgaccaagaaagaa
tacactactcagaagattcgccaagaatgggctgaagcagaacaggagcaaatcttccaa
atggacggaattgaaaattcgacaactgattggcagaatagcacattgcttccgcctaac
aacgaagaagacaaacattttaaaccaatcgaaacagttcctacctcaacggaatctaaa
ctaacaaattcggagctagcttctcaagaagatcaacaggcacagttgctagaggacaag
actaatgcggattctaaatcaaaaaagaaacgcaggaagcgatcgattatgaagaagaaa
aattctcaacgcaaaaactcgtccagcagttctggaggatcaaaccattcggatccgaac
gatggcgttgaaacagatagtattactgcatcgcaacctactgcctcatcagctagtgga
tctcccaaggaaggtgaacctgaaaatttaacagctactccagcagaaaatgcaccaaaa
gaaattccagagctatcaaaccgaggtcatgaattagatattcatttcttcagtgatact
gaagttacagctggtgttagtccacgccaatctcgcccttcaactccgatacaaagtgac
acggagtttgaaatttcacaacgcgagaatgttgaaggcgatagcatgtccgcttcttgg
aagtggggagaactcccaacaaaaccagaagagattgaagatttgagtacctctcagggc
aaacaagctcaacgtaattcaatgctaagtggtttgatgagttttatgaaatataacaac
aagaaaatgcggaaaaatgttccagatggtttgtatctttcggatcttgacgaatctttg
gaccctgaagtggctgctctctactttccacccgtttcatctaaagcacagcatgctcaa
actgaagaagacagagaaagtggcaatgggacatctctgccgcatagtccgacatcgctc
gaaggtgtgaagagtctggattccgattttgacgataacaaggataaactttcgttagat
ttcatcgctctttcactctgtggtggtttggacagtggtacaccaacgtatgaagaattt
gaaaagcatcgtcttcagtacgccgatgtctgtaacagtccgaccattttttcatcaccg
gatctagtagtgagaatcaatgacaaatactgttcatggcaagccgcttgccctcaggtg
atgactatgcttgcattccaaaaatctcttcccactgagcaagccgaaactcctagcaaa
ccgaaatcactggacgtcgctacagctggttctgtagaagctgatgcacaatccaccaag
caacaagtttcgcagacatcttcggaagccaatcgaggaggacgttggtggtattggcgt
agatcgaacgacaaatcaaccatgaaaaccgaaaatgagactgaacaacagtcgaaaact
tcggctatagctactcagacttctcgatcaaatactccggaagatgttggaacaatgaca
gaaagtttcagcaagactaaagaggatggatataatggatctctaagttcggaagattct
gagctgccctcagatcagccaacaaaccaggagctcattttgaacaaatcggacagtttc
attgagaaataccgaaaaacgcttcgcctgtcgtccgaacaaatcgaaagcctcaatctt
aacgatggtatgaatgaaatcgtattcagtgtaaccactgcctaccaaggaaccactcgt
tgcaaatgctatttgttcaagtggagatacaacgacaaagtggtgatctctgatatcgat
ggaaccattacaaaatctgatgttcttgggcatattctaccaatggtcggcagaaactgg
gaacaaattggcgtcgcccagctcttctcgaaaattgaagaaaatggctacaaaatgttg
tacctttcagcacgtgccattggccaagcgaagactaccagagattatttgcagtctatt
cggcagggagatgtgaagttaccggatggtccgttgctcctaaatcctacctcgctaatg
tcagccttccatcgagaagttatcgaaaagaagccggagcagttcaaaatagcttgtctt
agtgacattcaagctctgttccctgataaaaaccccttctacgcgggatatggcaacaga
ataaacgatgtctgggcttatcgtgcagttggaatacccatctctcgcattttcaccatc
aacacaaagggcgaactgaagcatgaattgacgcaaacattccaatctacttacgcaaac
atggcatacattgtagatcaactattcccacccatcaaacacatagaagaagaggatagc
gagttcaccagtttcaactactggcgggatccagtaccggacatcgacttgaatctcgat
ttgtccagcagctctcagagtggaagcggcagttctacgccggtatcgcttctatcggga
aaagtaactcccactagcacactggtacaacaggctctacctactattccggaaaattaa

DBGET integrated database retrieval system